Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1545
Gene name	Cytochrome P450 family 1 subfamily B member 1
Gene symbol	CYP1B1
Synonyms (NCBI Gene)	ASGD6CP1BCYPIB1GLC3AP4501B1
Chromosome	2
Chromosome location	2p22.2
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded

Show/Hide all (30)

SNP ID	Visualize variation	Clinical significance	Consequence
rs9282671	A>T	Pathogenic, conflicting-interpretations-of-pathogenicity, uncertain-significance, benign	Coding sequence variant, missense variant
rs28936700	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs28936701	G>A	Pathogenic	Coding sequence variant, missense variant
rs55771538	C>A,G,T	Pathogenic	Coding sequence variant, missense variant
rs55989760	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs56010818	C>T	Pathogenic	Coding sequence variant, missense variant
rs72549380	TCTGCCTGCACTC>-	Pathogenic	Coding sequence variant, frameshift variant
rs72549387	C>G,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs72549389	A>G	Pathogenic	Initiator codon variant, missense variant
rs79204362	C>T	Pathogenic, conflicting-interpretations-of-pathogenicity, not-provided, uncertain-significance	Coding sequence variant, missense variant
rs104893622	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs104893628	C>G	Pathogenic	Coding sequence variant, missense variant
rs104893629	T>A	Pathogenic	Coding sequence variant, missense variant
rs146770394	A>C,G	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, synonymous variant
rs148542782	G>A,T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs201824781	G>A	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs377049098	G>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs587778873	TGGCATGAGG>-,TGGCATGAGGTGGCATGAGG	Pathogenic	Coding sequence variant, frameshift variant
rs587778875	->G	Pathogenic, uncertain-significance	Coding sequence variant, frameshift variant
rs749073455	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs751768343	GGGTTT>-	Pathogenic	Inframe deletion, coding sequence variant
rs766425037	A>-	Pathogenic	Coding sequence variant, stop gained
rs771076928	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs777678299	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs893198212	C>A,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs944452644	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs1064792896	CTGCCTGCACTCG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1558603396	G>T	Pathogenic	Coding sequence variant, missense variant
rs1573274915	CAGT>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1573277080	G>A	Pathogenic	5 prime UTR variant

733

Show/Hide all (733)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004826	hsa-miR-27b-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	16982751
MIRT002598	hsa-miR-124-3p	Microarray	15685193
MIRT019543	hsa-miR-340-5p	Sequencing	20371350
MIRT002598	hsa-miR-124-3p	Microarray	18668037
MIRT002598	hsa-miR-124-3p	Microarray	15685193
MIRT004826	hsa-miR-27b-3p	Reporter assay;Other	16982751
MIRT024201	hsa-miR-221-3p	Sequencing	20371350
MIRT004826	hsa-miR-27b-3p	qRT-PCRWestern blot	24614526
MIRT719657	hsa-miR-548e-5p	HITS-CLIP	19536157
MIRT719656	hsa-miR-5007-5p	HITS-CLIP	19536157
MIRT719655	hsa-miR-3976	HITS-CLIP	19536157
MIRT719654	hsa-miR-3148	HITS-CLIP	19536157
MIRT719653	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT715013	hsa-miR-6760-3p	HITS-CLIP	19536157
MIRT715012	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT715011	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT715010	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT715009	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT715008	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT715007	hsa-miR-511-5p	HITS-CLIP	19536157
MIRT004826	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT478510	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT485658	hsa-miR-548an	PAR-CLIP	23592263
MIRT485656	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT485657	hsa-miR-4484	PAR-CLIP	23592263
MIRT478509	hsa-miR-141-3p	PAR-CLIP	23592263
MIRT478508	hsa-miR-200a-3p	PAR-CLIP	23592263
MIRT478507	hsa-miR-148a-5p	PAR-CLIP	23592263
MIRT478504	hsa-miR-148b-5p	PAR-CLIP	23592263
MIRT478503	hsa-miR-6874-3p	PAR-CLIP	23592263
MIRT478502	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT478501	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT478500	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT478499	hsa-miR-619-5p	PAR-CLIP	23592263
MIRT478498	hsa-miR-6506-5p	PAR-CLIP	23592263
MIRT478497	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT478496	hsa-miR-4314	PAR-CLIP	23592263
MIRT478495	hsa-miR-1302	PAR-CLIP	23592263
MIRT478494	hsa-miR-4298	PAR-CLIP	23592263
MIRT004826	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT478510	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT478509	hsa-miR-141-3p	PAR-CLIP	23592263
MIRT478508	hsa-miR-200a-3p	PAR-CLIP	23592263
MIRT478507	hsa-miR-148a-5p	PAR-CLIP	23592263
MIRT478506	hsa-miR-208a-5p	PAR-CLIP	23592263
MIRT478505	hsa-miR-208b-5p	PAR-CLIP	23592263
MIRT478504	hsa-miR-148b-5p	PAR-CLIP	23592263
MIRT478503	hsa-miR-6874-3p	PAR-CLIP	23592263
MIRT478502	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT478501	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT478500	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT478499	hsa-miR-619-5p	PAR-CLIP	23592263
MIRT478498	hsa-miR-6506-5p	PAR-CLIP	23592263
MIRT478497	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT478496	hsa-miR-4314	PAR-CLIP	23592263
MIRT478495	hsa-miR-1302	PAR-CLIP	23592263
MIRT478494	hsa-miR-4298	PAR-CLIP	23592263
MIRT719657	hsa-miR-548e-5p	HITS-CLIP	19536157
MIRT719656	hsa-miR-5007-5p	HITS-CLIP	19536157
MIRT719655	hsa-miR-3976	HITS-CLIP	19536157
MIRT719654	hsa-miR-3148	HITS-CLIP	19536157
MIRT719653	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT715013	hsa-miR-6760-3p	HITS-CLIP	19536157
MIRT715012	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT715011	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT715010	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT715009	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT715008	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT715007	hsa-miR-511-5p	HITS-CLIP	19536157
MIRT004826	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT478510	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT485658	hsa-miR-548an	PAR-CLIP	23592263
MIRT485656	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT485657	hsa-miR-4484	PAR-CLIP	23592263
MIRT478509	hsa-miR-141-3p	PAR-CLIP	23592263
MIRT478508	hsa-miR-200a-3p	PAR-CLIP	23592263
MIRT478507	hsa-miR-148a-5p	PAR-CLIP	23592263
MIRT478504	hsa-miR-148b-5p	PAR-CLIP	23592263
MIRT478503	hsa-miR-6874-3p	PAR-CLIP	23592263
MIRT478502	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT478501	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT478500	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT478499	hsa-miR-619-5p	PAR-CLIP	23592263
MIRT478498	hsa-miR-6506-5p	PAR-CLIP	23592263
MIRT478497	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT478496	hsa-miR-4314	PAR-CLIP	23592263
MIRT478495	hsa-miR-1302	PAR-CLIP	23592263
MIRT478494	hsa-miR-4298	PAR-CLIP	23592263
MIRT004826	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT478510	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT478509	hsa-miR-141-3p	PAR-CLIP	23592263
MIRT478508	hsa-miR-200a-3p	PAR-CLIP	23592263
MIRT478507	hsa-miR-148a-5p	PAR-CLIP	23592263
MIRT478506	hsa-miR-208a-5p	PAR-CLIP	23592263
MIRT478505	hsa-miR-208b-5p	PAR-CLIP	23592263
MIRT478504	hsa-miR-148b-5p	PAR-CLIP	23592263
MIRT478503	hsa-miR-6874-3p	PAR-CLIP	23592263
MIRT478502	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT478501	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT478500	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT478499	hsa-miR-619-5p	PAR-CLIP	23592263
MIRT478498	hsa-miR-6506-5p	PAR-CLIP	23592263
MIRT478497	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT478496	hsa-miR-4314	PAR-CLIP	23592263
MIRT478495	hsa-miR-1302	PAR-CLIP	23592263
MIRT478494	hsa-miR-4298	PAR-CLIP	23592263
MIRT004826	hsa-miR-27b-3p	Western blottingqRT-PCR	37371125
MIRT920627	hsa-miR-1179	CLIP-seq
MIRT920628	hsa-miR-1244	CLIP-seq
MIRT920629	hsa-miR-129-5p	CLIP-seq
MIRT920630	hsa-miR-1298	CLIP-seq
MIRT920631	hsa-miR-141	CLIP-seq
MIRT920632	hsa-miR-142-5p	CLIP-seq
MIRT920633	hsa-miR-181a	CLIP-seq
MIRT920634	hsa-miR-181b	CLIP-seq
MIRT920635	hsa-miR-181c	CLIP-seq
MIRT920636	hsa-miR-181d	CLIP-seq
MIRT920637	hsa-miR-186	CLIP-seq
MIRT920638	hsa-miR-199a-3p	CLIP-seq
MIRT920639	hsa-miR-199b-3p	CLIP-seq
MIRT920640	hsa-miR-200a	CLIP-seq
MIRT920641	hsa-miR-200b	CLIP-seq
MIRT920642	hsa-miR-200c	CLIP-seq
MIRT920643	hsa-miR-204	CLIP-seq
MIRT920644	hsa-miR-211	CLIP-seq
MIRT920645	hsa-miR-27a	CLIP-seq
MIRT920646	hsa-miR-27b	CLIP-seq
MIRT920647	hsa-miR-3124-3p	CLIP-seq
MIRT920648	hsa-miR-3129-5p	CLIP-seq
MIRT920649	hsa-miR-3145-5p	CLIP-seq
MIRT920650	hsa-miR-3166	CLIP-seq
MIRT920651	hsa-miR-3192	CLIP-seq
MIRT920652	hsa-miR-323b-5p	CLIP-seq
MIRT920653	hsa-miR-345	CLIP-seq
MIRT920654	hsa-miR-362-5p	CLIP-seq
MIRT920655	hsa-miR-3657	CLIP-seq
MIRT920656	hsa-miR-3692	CLIP-seq
MIRT920657	hsa-miR-369-3p	CLIP-seq
MIRT920658	hsa-miR-374a	CLIP-seq
MIRT920659	hsa-miR-374b	CLIP-seq
MIRT920660	hsa-miR-377	CLIP-seq
MIRT920661	hsa-miR-3920	CLIP-seq
MIRT920662	hsa-miR-3924	CLIP-seq
MIRT920663	hsa-miR-3942-3p	CLIP-seq
MIRT920664	hsa-miR-3977	CLIP-seq
MIRT920665	hsa-miR-410	CLIP-seq
MIRT920666	hsa-miR-4254	CLIP-seq
MIRT920667	hsa-miR-4256	CLIP-seq
MIRT920668	hsa-miR-4262	CLIP-seq
MIRT920669	hsa-miR-4272	CLIP-seq
MIRT920670	hsa-miR-429	CLIP-seq
MIRT920671	hsa-miR-4297	CLIP-seq
MIRT920672	hsa-miR-433	CLIP-seq
MIRT920673	hsa-miR-4422	CLIP-seq
MIRT920674	hsa-miR-4446-5p	CLIP-seq
MIRT920675	hsa-miR-4477a	CLIP-seq
MIRT920676	hsa-miR-4496	CLIP-seq
MIRT920677	hsa-miR-4650-3p	CLIP-seq
MIRT920678	hsa-miR-4666-3p	CLIP-seq
MIRT920679	hsa-miR-4705	CLIP-seq
MIRT920680	hsa-miR-4724-3p	CLIP-seq
MIRT920681	hsa-miR-4755-5p	CLIP-seq
MIRT920682	hsa-miR-4760-3p	CLIP-seq
MIRT920683	hsa-miR-4760-5p	CLIP-seq
MIRT920684	hsa-miR-4768-3p	CLIP-seq
MIRT920685	hsa-miR-4768-5p	CLIP-seq
MIRT920686	hsa-miR-4795-3p	CLIP-seq
MIRT920687	hsa-miR-499-3p	CLIP-seq
MIRT920688	hsa-miR-499a-3p	CLIP-seq
MIRT920689	hsa-miR-500b	CLIP-seq
MIRT920690	hsa-miR-501-5p	CLIP-seq
MIRT920691	hsa-miR-508-5p	CLIP-seq
MIRT920692	hsa-miR-545	CLIP-seq
MIRT920693	hsa-miR-548a-3p	CLIP-seq
MIRT920694	hsa-miR-548a-5p	CLIP-seq
MIRT920695	hsa-miR-548ab	CLIP-seq
MIRT920696	hsa-miR-548ak	CLIP-seq
MIRT920697	hsa-miR-548b-5p	CLIP-seq
MIRT920698	hsa-miR-548c-5p	CLIP-seq
MIRT920699	hsa-miR-548d-5p	CLIP-seq
MIRT920700	hsa-miR-548e	CLIP-seq
MIRT920701	hsa-miR-548f	CLIP-seq
MIRT920702	hsa-miR-548h	CLIP-seq
MIRT920703	hsa-miR-548i	CLIP-seq
MIRT920704	hsa-miR-548j	CLIP-seq
MIRT920705	hsa-miR-548k	CLIP-seq
MIRT920706	hsa-miR-548l	CLIP-seq
MIRT920707	hsa-miR-548n	CLIP-seq
MIRT920708	hsa-miR-548p	CLIP-seq
MIRT920709	hsa-miR-548t	CLIP-seq
MIRT920710	hsa-miR-548w	CLIP-seq
MIRT920711	hsa-miR-548y	CLIP-seq
MIRT920712	hsa-miR-559	CLIP-seq
MIRT920713	hsa-miR-583	CLIP-seq
MIRT920714	hsa-miR-587	CLIP-seq
MIRT920715	hsa-miR-603	CLIP-seq
MIRT920716	hsa-miR-619	CLIP-seq
MIRT920717	hsa-miR-623	CLIP-seq
MIRT920718	hsa-miR-664	CLIP-seq
MIRT920719	hsa-miR-766	CLIP-seq
MIRT920720	hsa-miR-802	CLIP-seq
MIRT920721	hsa-miR-935	CLIP-seq
MIRT920722	hsa-miR-936	CLIP-seq
MIRT1547770	hsa-miR-1183	CLIP-seq
MIRT1547771	hsa-miR-1200	CLIP-seq
MIRT1547772	hsa-miR-1283	CLIP-seq
MIRT1547773	hsa-miR-1305	CLIP-seq
MIRT1547774	hsa-miR-137	CLIP-seq
MIRT1547775	hsa-miR-154	CLIP-seq
MIRT920633	hsa-miR-181a	CLIP-seq
MIRT920634	hsa-miR-181b	CLIP-seq
MIRT920635	hsa-miR-181c	CLIP-seq
MIRT920636	hsa-miR-181d	CLIP-seq
MIRT1547776	hsa-miR-221	CLIP-seq
MIRT1547777	hsa-miR-222	CLIP-seq
MIRT1547778	hsa-miR-2355-5p	CLIP-seq
MIRT1547779	hsa-miR-25	CLIP-seq
MIRT1547780	hsa-miR-28-3p	CLIP-seq
MIRT1547781	hsa-miR-302f	CLIP-seq
MIRT1547782	hsa-miR-3074-5p	CLIP-seq
MIRT1547783	hsa-miR-3137	CLIP-seq
MIRT1547784	hsa-miR-3140-5p	CLIP-seq
MIRT1547785	hsa-miR-32	CLIP-seq
MIRT920652	hsa-miR-323b-5p	CLIP-seq
MIRT1547786	hsa-miR-3613-5p	CLIP-seq
MIRT1547787	hsa-miR-3614-5p	CLIP-seq
MIRT1547788	hsa-miR-3618	CLIP-seq
MIRT1547789	hsa-miR-363	CLIP-seq
MIRT1547790	hsa-miR-367	CLIP-seq
MIRT1547791	hsa-miR-3679-3p	CLIP-seq
MIRT920660	hsa-miR-377	CLIP-seq
MIRT920661	hsa-miR-3920	CLIP-seq
MIRT1547792	hsa-miR-409-3p	CLIP-seq
MIRT920668	hsa-miR-4262	CLIP-seq
MIRT920669	hsa-miR-4272	CLIP-seq
MIRT1547793	hsa-miR-4282	CLIP-seq
MIRT920673	hsa-miR-4422	CLIP-seq
MIRT920675	hsa-miR-4477a	CLIP-seq
MIRT920676	hsa-miR-4496	CLIP-seq
MIRT1547794	hsa-miR-4528	CLIP-seq
MIRT1547795	hsa-miR-4714-3p	CLIP-seq
MIRT1547796	hsa-miR-4738-3p	CLIP-seq
MIRT920682	hsa-miR-4760-3p	CLIP-seq
MIRT920686	hsa-miR-4795-3p	CLIP-seq
MIRT1547797	hsa-miR-4796-5p	CLIP-seq
MIRT1547798	hsa-miR-501-3p	CLIP-seq
MIRT1547799	hsa-miR-502-3p	CLIP-seq
MIRT920692	hsa-miR-545	CLIP-seq
MIRT920693	hsa-miR-548a-3p	CLIP-seq
MIRT1547800	hsa-miR-548ac	CLIP-seq
MIRT1547801	hsa-miR-548ae	CLIP-seq
MIRT1547802	hsa-miR-548aj	CLIP-seq
MIRT1547803	hsa-miR-548am	CLIP-seq
MIRT1547804	hsa-miR-548d-3p	CLIP-seq
MIRT920700	hsa-miR-548e	CLIP-seq
MIRT920701	hsa-miR-548f	CLIP-seq
MIRT1547805	hsa-miR-548x	CLIP-seq
MIRT1547806	hsa-miR-548z	CLIP-seq
MIRT920715	hsa-miR-603	CLIP-seq
MIRT1547807	hsa-miR-656	CLIP-seq
MIRT1547808	hsa-miR-889	CLIP-seq
MIRT1547809	hsa-miR-891b	CLIP-seq
MIRT1547810	hsa-miR-92a	CLIP-seq
MIRT1547811	hsa-miR-92b	CLIP-seq
MIRT1547812	hsa-miR-934	CLIP-seq
MIRT1547770	hsa-miR-1183	CLIP-seq
MIRT1972819	hsa-miR-1197	CLIP-seq
MIRT1547771	hsa-miR-1200	CLIP-seq
MIRT1972820	hsa-miR-1236	CLIP-seq
MIRT1547772	hsa-miR-1283	CLIP-seq
MIRT920629	hsa-miR-129-5p	CLIP-seq
MIRT920630	hsa-miR-1298	CLIP-seq
MIRT920631	hsa-miR-141	CLIP-seq
MIRT920633	hsa-miR-181a	CLIP-seq
MIRT920634	hsa-miR-181b	CLIP-seq
MIRT920635	hsa-miR-181c	CLIP-seq
MIRT920636	hsa-miR-181d	CLIP-seq
MIRT920640	hsa-miR-200a	CLIP-seq
MIRT1972821	hsa-miR-2054	CLIP-seq
MIRT1547778	hsa-miR-2355-5p	CLIP-seq
MIRT920645	hsa-miR-27a	CLIP-seq
MIRT920646	hsa-miR-27b	CLIP-seq
MIRT1972822	hsa-miR-3065-5p	CLIP-seq
MIRT1547782	hsa-miR-3074-5p	CLIP-seq
MIRT1972823	hsa-miR-3117-3p	CLIP-seq
MIRT1972824	hsa-miR-3120-5p	CLIP-seq
MIRT920647	hsa-miR-3124-3p	CLIP-seq
MIRT1547784	hsa-miR-3140-5p	CLIP-seq
MIRT920649	hsa-miR-3145-5p	CLIP-seq
MIRT920651	hsa-miR-3192	CLIP-seq
MIRT1972825	hsa-miR-330-3p	CLIP-seq
MIRT1972826	hsa-miR-338-5p	CLIP-seq
MIRT1547788	hsa-miR-3618	CLIP-seq
MIRT1972827	hsa-miR-3672	CLIP-seq
MIRT1547791	hsa-miR-3679-3p	CLIP-seq
MIRT920656	hsa-miR-3692	CLIP-seq
MIRT920657	hsa-miR-369-3p	CLIP-seq
MIRT920661	hsa-miR-3920	CLIP-seq
MIRT920663	hsa-miR-3942-3p	CLIP-seq
MIRT1547792	hsa-miR-409-3p	CLIP-seq
MIRT1972828	hsa-miR-421	CLIP-seq
MIRT920668	hsa-miR-4262	CLIP-seq
MIRT1972829	hsa-miR-4436b-5p	CLIP-seq
MIRT1972830	hsa-miR-4502	CLIP-seq
MIRT1972831	hsa-miR-4659a-3p	CLIP-seq
MIRT1972832	hsa-miR-4659b-3p	CLIP-seq
MIRT1972833	hsa-miR-4712-3p	CLIP-seq
MIRT1972834	hsa-miR-4719	CLIP-seq
MIRT1972835	hsa-miR-4724-5p	CLIP-seq
MIRT920684	hsa-miR-4768-3p	CLIP-seq
MIRT920685	hsa-miR-4768-5p	CLIP-seq
MIRT920686	hsa-miR-4795-3p	CLIP-seq
MIRT1972836	hsa-miR-489	CLIP-seq
MIRT920691	hsa-miR-508-5p	CLIP-seq
MIRT1972837	hsa-miR-511	CLIP-seq
MIRT1972838	hsa-miR-514	CLIP-seq
MIRT1972839	hsa-miR-514b-3p	CLIP-seq
MIRT920692	hsa-miR-545	CLIP-seq
MIRT920714	hsa-miR-587	CLIP-seq
MIRT1972840	hsa-miR-593	CLIP-seq
MIRT920719	hsa-miR-766	CLIP-seq
MIRT1547812	hsa-miR-934	CLIP-seq
MIRT920721	hsa-miR-935	CLIP-seq
MIRT1972820	hsa-miR-1236	CLIP-seq
MIRT920631	hsa-miR-141	CLIP-seq
MIRT920632	hsa-miR-142-5p	CLIP-seq
MIRT920640	hsa-miR-200a	CLIP-seq
MIRT2208470	hsa-miR-2115	CLIP-seq
MIRT920645	hsa-miR-27a	CLIP-seq
MIRT920646	hsa-miR-27b	CLIP-seq
MIRT1972822	hsa-miR-3065-5p	CLIP-seq
MIRT1972824	hsa-miR-3120-5p	CLIP-seq
MIRT2208471	hsa-miR-3143	CLIP-seq
MIRT920649	hsa-miR-3145-5p	CLIP-seq
MIRT920651	hsa-miR-3192	CLIP-seq
MIRT1972826	hsa-miR-338-5p	CLIP-seq
MIRT920653	hsa-miR-345	CLIP-seq
MIRT2208472	hsa-miR-3613-3p	CLIP-seq
MIRT920660	hsa-miR-377	CLIP-seq
MIRT920661	hsa-miR-3920	CLIP-seq
MIRT1972828	hsa-miR-421	CLIP-seq
MIRT920667	hsa-miR-4256	CLIP-seq
MIRT920672	hsa-miR-433	CLIP-seq
MIRT920673	hsa-miR-4422	CLIP-seq
MIRT920675	hsa-miR-4477a	CLIP-seq
MIRT920679	hsa-miR-4705	CLIP-seq
MIRT1972834	hsa-miR-4719	CLIP-seq
MIRT2208473	hsa-miR-4803	CLIP-seq
MIRT2208474	hsa-miR-491-3p	CLIP-seq
MIRT920691	hsa-miR-508-5p	CLIP-seq
MIRT1972837	hsa-miR-511	CLIP-seq
MIRT920693	hsa-miR-548a-3p	CLIP-seq
MIRT920694	hsa-miR-548a-5p	CLIP-seq
MIRT920695	hsa-miR-548ab	CLIP-seq
MIRT1547800	hsa-miR-548ac	CLIP-seq
MIRT1547801	hsa-miR-548ae	CLIP-seq
MIRT1547802	hsa-miR-548aj	CLIP-seq
MIRT920696	hsa-miR-548ak	CLIP-seq
MIRT1547803	hsa-miR-548am	CLIP-seq
MIRT920697	hsa-miR-548b-5p	CLIP-seq
MIRT920698	hsa-miR-548c-5p	CLIP-seq
MIRT1547804	hsa-miR-548d-3p	CLIP-seq
MIRT920699	hsa-miR-548d-5p	CLIP-seq
MIRT920700	hsa-miR-548e	CLIP-seq
MIRT920701	hsa-miR-548f	CLIP-seq
MIRT920702	hsa-miR-548h	CLIP-seq
MIRT920703	hsa-miR-548i	CLIP-seq
MIRT920704	hsa-miR-548j	CLIP-seq
MIRT920705	hsa-miR-548k	CLIP-seq
MIRT920706	hsa-miR-548l	CLIP-seq
MIRT920710	hsa-miR-548w	CLIP-seq
MIRT1547805	hsa-miR-548x	CLIP-seq
MIRT920711	hsa-miR-548y	CLIP-seq
MIRT1547806	hsa-miR-548z	CLIP-seq
MIRT920712	hsa-miR-559	CLIP-seq
MIRT2208475	hsa-miR-592	CLIP-seq
MIRT1972840	hsa-miR-593	CLIP-seq
MIRT2208476	hsa-miR-597	CLIP-seq
MIRT2208477	hsa-miR-599	CLIP-seq
MIRT920715	hsa-miR-603	CLIP-seq
MIRT920720	hsa-miR-802	CLIP-seq
MIRT920631	hsa-miR-141	CLIP-seq
MIRT920640	hsa-miR-200a	CLIP-seq
MIRT920645	hsa-miR-27a	CLIP-seq
MIRT920646	hsa-miR-27b	CLIP-seq
MIRT2386644	hsa-miR-3198	CLIP-seq
MIRT1547788	hsa-miR-3618	CLIP-seq
MIRT2386645	hsa-miR-4309	CLIP-seq
MIRT2386646	hsa-miR-432	CLIP-seq
MIRT2386647	hsa-miR-4653-3p	CLIP-seq
MIRT920685	hsa-miR-4768-5p	CLIP-seq
MIRT920687	hsa-miR-499-3p	CLIP-seq
MIRT920688	hsa-miR-499a-3p	CLIP-seq
MIRT920720	hsa-miR-802	CLIP-seq
MIRT1547812	hsa-miR-934	CLIP-seq
MIRT1547774	hsa-miR-137	CLIP-seq
MIRT920631	hsa-miR-141	CLIP-seq
MIRT920640	hsa-miR-200a	CLIP-seq
MIRT1547779	hsa-miR-25	CLIP-seq
MIRT920645	hsa-miR-27a	CLIP-seq
MIRT920646	hsa-miR-27b	CLIP-seq
MIRT2208471	hsa-miR-3143	CLIP-seq
MIRT920651	hsa-miR-3192	CLIP-seq
MIRT1547785	hsa-miR-32	CLIP-seq
MIRT1547789	hsa-miR-363	CLIP-seq
MIRT2428041	hsa-miR-3646	CLIP-seq
MIRT1547790	hsa-miR-367	CLIP-seq
MIRT920660	hsa-miR-377	CLIP-seq
MIRT920673	hsa-miR-4422	CLIP-seq
MIRT920675	hsa-miR-4477a	CLIP-seq
MIRT1547794	hsa-miR-4528	CLIP-seq
MIRT920678	hsa-miR-4666-3p	CLIP-seq
MIRT1972834	hsa-miR-4719	CLIP-seq
MIRT2428042	hsa-miR-4775	CLIP-seq
MIRT2208473	hsa-miR-4803	CLIP-seq
MIRT1547800	hsa-miR-548ac	CLIP-seq
MIRT1547801	hsa-miR-548ae	CLIP-seq
MIRT1547802	hsa-miR-548aj	CLIP-seq
MIRT1547803	hsa-miR-548am	CLIP-seq
MIRT1547804	hsa-miR-548d-3p	CLIP-seq
MIRT1547805	hsa-miR-548x	CLIP-seq
MIRT1547806	hsa-miR-548z	CLIP-seq
MIRT2208475	hsa-miR-592	CLIP-seq
MIRT2208476	hsa-miR-597	CLIP-seq
MIRT2208477	hsa-miR-599	CLIP-seq
MIRT920720	hsa-miR-802	CLIP-seq
MIRT1547810	hsa-miR-92a	CLIP-seq
MIRT1547811	hsa-miR-92b	CLIP-seq
MIRT2436587	hsa-miR-2052	CLIP-seq
MIRT2436588	hsa-miR-3978	CLIP-seq
MIRT920653	hsa-miR-345	CLIP-seq
MIRT920667	hsa-miR-4256	CLIP-seq
MIRT2447886	hsa-miR-4690-5p	CLIP-seq
MIRT920653	hsa-miR-345	CLIP-seq
MIRT920667	hsa-miR-4256	CLIP-seq
MIRT2447886	hsa-miR-4690-5p	CLIP-seq
MIRT1547771	hsa-miR-1200	CLIP-seq
MIRT2512299	hsa-miR-1224-3p	CLIP-seq
MIRT2512300	hsa-miR-1256	CLIP-seq
MIRT2512301	hsa-miR-1260	CLIP-seq
MIRT2512302	hsa-miR-1260b	CLIP-seq
MIRT2512303	hsa-miR-1271	CLIP-seq
MIRT2512304	hsa-miR-1280	CLIP-seq
MIRT1547773	hsa-miR-1305	CLIP-seq
MIRT2512305	hsa-miR-1323	CLIP-seq
MIRT2512306	hsa-miR-135a	CLIP-seq
MIRT2512307	hsa-miR-135b	CLIP-seq
MIRT1547774	hsa-miR-137	CLIP-seq
MIRT1547775	hsa-miR-154	CLIP-seq
MIRT920633	hsa-miR-181a	CLIP-seq
MIRT920634	hsa-miR-181b	CLIP-seq
MIRT920635	hsa-miR-181c	CLIP-seq
MIRT920636	hsa-miR-181d	CLIP-seq
MIRT2512308	hsa-miR-182	CLIP-seq
MIRT2512309	hsa-miR-188-3p	CLIP-seq
MIRT920641	hsa-miR-200b	CLIP-seq
MIRT920642	hsa-miR-200c	CLIP-seq
MIRT2436587	hsa-miR-2052	CLIP-seq
MIRT1972821	hsa-miR-2054	CLIP-seq
MIRT2208470	hsa-miR-2115	CLIP-seq
MIRT2512310	hsa-miR-223	CLIP-seq
MIRT1547779	hsa-miR-25	CLIP-seq
MIRT1547780	hsa-miR-28-3p	CLIP-seq
MIRT1547781	hsa-miR-302f	CLIP-seq
MIRT1547782	hsa-miR-3074-5p	CLIP-seq
MIRT2512311	hsa-miR-31	CLIP-seq
MIRT2512312	hsa-miR-3119	CLIP-seq
MIRT2512313	hsa-miR-3121-3p	CLIP-seq
MIRT2512314	hsa-miR-3133	CLIP-seq
MIRT1547784	hsa-miR-3140-5p	CLIP-seq
MIRT2512315	hsa-miR-3156-3p	CLIP-seq
MIRT2512316	hsa-miR-3163	CLIP-seq
MIRT2512317	hsa-miR-3182	CLIP-seq
MIRT2386644	hsa-miR-3198	CLIP-seq
MIRT1547785	hsa-miR-32	CLIP-seq
MIRT2512318	hsa-miR-320a	CLIP-seq
MIRT2512319	hsa-miR-320b	CLIP-seq
MIRT2512320	hsa-miR-320c	CLIP-seq
MIRT2512321	hsa-miR-320d	CLIP-seq
MIRT2512322	hsa-miR-323-3p	CLIP-seq
MIRT920652	hsa-miR-323b-5p	CLIP-seq
MIRT1972825	hsa-miR-330-3p	CLIP-seq
MIRT2512323	hsa-miR-340	CLIP-seq
MIRT920653	hsa-miR-345	CLIP-seq
MIRT2208472	hsa-miR-3613-3p	CLIP-seq
MIRT1547786	hsa-miR-3613-5p	CLIP-seq
MIRT2512324	hsa-miR-3622b-5p	CLIP-seq
MIRT920654	hsa-miR-362-5p	CLIP-seq
MIRT1547789	hsa-miR-363	CLIP-seq
MIRT2428041	hsa-miR-3646	CLIP-seq
MIRT2512325	hsa-miR-3652	CLIP-seq
MIRT1547790	hsa-miR-367	CLIP-seq
MIRT2512326	hsa-miR-3671	CLIP-seq
MIRT2512327	hsa-miR-3673	CLIP-seq
MIRT2512328	hsa-miR-3674	CLIP-seq
MIRT2512329	hsa-miR-3686	CLIP-seq
MIRT920661	hsa-miR-3920	CLIP-seq
MIRT2436588	hsa-miR-3978	CLIP-seq
MIRT1547792	hsa-miR-409-3p	CLIP-seq
MIRT2512330	hsa-miR-409-5p	CLIP-seq
MIRT920666	hsa-miR-4254	CLIP-seq
MIRT920667	hsa-miR-4256	CLIP-seq
MIRT920668	hsa-miR-4262	CLIP-seq
MIRT920669	hsa-miR-4272	CLIP-seq
MIRT1547793	hsa-miR-4282	CLIP-seq
MIRT920670	hsa-miR-429	CLIP-seq
MIRT2386645	hsa-miR-4309	CLIP-seq
MIRT2386646	hsa-miR-432	CLIP-seq
MIRT2512331	hsa-miR-4320	CLIP-seq
MIRT2512332	hsa-miR-4429	CLIP-seq
MIRT2512333	hsa-miR-4430	CLIP-seq
MIRT2512334	hsa-miR-4453	CLIP-seq
MIRT2512335	hsa-miR-448	CLIP-seq
MIRT2512336	hsa-miR-4503	CLIP-seq
MIRT2512337	hsa-miR-4505	CLIP-seq
MIRT2512338	hsa-miR-4506	CLIP-seq
MIRT1547794	hsa-miR-4528	CLIP-seq
MIRT2512339	hsa-miR-4538	CLIP-seq
MIRT2386647	hsa-miR-4653-3p	CLIP-seq
MIRT2512340	hsa-miR-4659a-5p	CLIP-seq
MIRT2512341	hsa-miR-4659b-5p	CLIP-seq
MIRT2512342	hsa-miR-4666-5p	CLIP-seq
MIRT2512343	hsa-miR-4670-3p	CLIP-seq
MIRT2512344	hsa-miR-4686	CLIP-seq
MIRT2447886	hsa-miR-4690-5p	CLIP-seq
MIRT1547796	hsa-miR-4738-3p	CLIP-seq
MIRT2512345	hsa-miR-4742-3p	CLIP-seq
MIRT920682	hsa-miR-4760-3p	CLIP-seq
MIRT2512346	hsa-miR-4762-3p	CLIP-seq
MIRT920685	hsa-miR-4768-5p	CLIP-seq
MIRT2512347	hsa-miR-4778-5p	CLIP-seq
MIRT2512348	hsa-miR-4781-3p	CLIP-seq
MIRT2512349	hsa-miR-4786-5p	CLIP-seq
MIRT1547797	hsa-miR-4796-5p	CLIP-seq
MIRT1972836	hsa-miR-489	CLIP-seq
MIRT2512350	hsa-miR-490-3p	CLIP-seq
MIRT920687	hsa-miR-499-3p	CLIP-seq
MIRT920688	hsa-miR-499a-3p	CLIP-seq
MIRT920689	hsa-miR-500b	CLIP-seq
MIRT920690	hsa-miR-501-5p	CLIP-seq
MIRT1972837	hsa-miR-511	CLIP-seq
MIRT1972838	hsa-miR-514	CLIP-seq
MIRT1972839	hsa-miR-514b-3p	CLIP-seq
MIRT2512351	hsa-miR-544	CLIP-seq
MIRT920692	hsa-miR-545	CLIP-seq
MIRT920693	hsa-miR-548a-3p	CLIP-seq
MIRT920694	hsa-miR-548a-5p	CLIP-seq
MIRT920695	hsa-miR-548ab	CLIP-seq
MIRT920696	hsa-miR-548ak	CLIP-seq
MIRT920697	hsa-miR-548b-5p	CLIP-seq
MIRT2512352	hsa-miR-548c-3p	CLIP-seq
MIRT920698	hsa-miR-548c-5p	CLIP-seq
MIRT920699	hsa-miR-548d-5p	CLIP-seq
MIRT920700	hsa-miR-548e	CLIP-seq
MIRT920701	hsa-miR-548f	CLIP-seq
MIRT920702	hsa-miR-548h	CLIP-seq
MIRT920703	hsa-miR-548i	CLIP-seq
MIRT920704	hsa-miR-548j	CLIP-seq
MIRT920707	hsa-miR-548n	CLIP-seq
MIRT2512353	hsa-miR-548o	CLIP-seq
MIRT920708	hsa-miR-548p	CLIP-seq
MIRT920709	hsa-miR-548t	CLIP-seq
MIRT920710	hsa-miR-548w	CLIP-seq
MIRT920711	hsa-miR-548y	CLIP-seq
MIRT920712	hsa-miR-559	CLIP-seq
MIRT920713	hsa-miR-583	CLIP-seq
MIRT2512354	hsa-miR-584	CLIP-seq
MIRT920714	hsa-miR-587	CLIP-seq
MIRT2512355	hsa-miR-590-3p	CLIP-seq
MIRT2512356	hsa-miR-605	CLIP-seq
MIRT2512357	hsa-miR-607	CLIP-seq
MIRT920716	hsa-miR-619	CLIP-seq
MIRT2512358	hsa-miR-628-5p	CLIP-seq
MIRT2512359	hsa-miR-633	CLIP-seq
MIRT2512360	hsa-miR-647	CLIP-seq
MIRT2512361	hsa-miR-649	CLIP-seq
MIRT1547807	hsa-miR-656	CLIP-seq
MIRT920718	hsa-miR-664	CLIP-seq
MIRT2512362	hsa-miR-885-5p	CLIP-seq
MIRT1547808	hsa-miR-889	CLIP-seq
MIRT1547810	hsa-miR-92a	CLIP-seq
MIRT1547811	hsa-miR-92b	CLIP-seq
MIRT2512363	hsa-miR-96	CLIP-seq
MIRT1547771	hsa-miR-1200	CLIP-seq
MIRT2512299	hsa-miR-1224-3p	CLIP-seq
MIRT2512300	hsa-miR-1256	CLIP-seq
MIRT2512301	hsa-miR-1260	CLIP-seq
MIRT2512302	hsa-miR-1260b	CLIP-seq
MIRT2512303	hsa-miR-1271	CLIP-seq
MIRT2512304	hsa-miR-1280	CLIP-seq
MIRT920630	hsa-miR-1298	CLIP-seq
MIRT1547773	hsa-miR-1305	CLIP-seq
MIRT2512305	hsa-miR-1323	CLIP-seq
MIRT2512306	hsa-miR-135a	CLIP-seq
MIRT2512307	hsa-miR-135b	CLIP-seq
MIRT1547774	hsa-miR-137	CLIP-seq
MIRT1547775	hsa-miR-154	CLIP-seq
MIRT920633	hsa-miR-181a	CLIP-seq
MIRT920634	hsa-miR-181b	CLIP-seq
MIRT920635	hsa-miR-181c	CLIP-seq
MIRT920636	hsa-miR-181d	CLIP-seq
MIRT2512308	hsa-miR-182	CLIP-seq
MIRT2512309	hsa-miR-188-3p	CLIP-seq
MIRT920641	hsa-miR-200b	CLIP-seq
MIRT920642	hsa-miR-200c	CLIP-seq
MIRT2436587	hsa-miR-2052	CLIP-seq
MIRT1972821	hsa-miR-2054	CLIP-seq
MIRT2208470	hsa-miR-2115	CLIP-seq
MIRT2512310	hsa-miR-223	CLIP-seq
MIRT1547779	hsa-miR-25	CLIP-seq
MIRT1547780	hsa-miR-28-3p	CLIP-seq
MIRT1547781	hsa-miR-302f	CLIP-seq
MIRT1547782	hsa-miR-3074-5p	CLIP-seq
MIRT2512311	hsa-miR-31	CLIP-seq
MIRT2512312	hsa-miR-3119	CLIP-seq
MIRT2512313	hsa-miR-3121-3p	CLIP-seq
MIRT2512314	hsa-miR-3133	CLIP-seq
MIRT1547784	hsa-miR-3140-5p	CLIP-seq
MIRT2512315	hsa-miR-3156-3p	CLIP-seq
MIRT2512316	hsa-miR-3163	CLIP-seq
MIRT920650	hsa-miR-3166	CLIP-seq
MIRT2512317	hsa-miR-3182	CLIP-seq
MIRT2386644	hsa-miR-3198	CLIP-seq
MIRT1547785	hsa-miR-32	CLIP-seq
MIRT2512318	hsa-miR-320a	CLIP-seq
MIRT2512319	hsa-miR-320b	CLIP-seq
MIRT2512320	hsa-miR-320c	CLIP-seq
MIRT2512321	hsa-miR-320d	CLIP-seq
MIRT2512322	hsa-miR-323-3p	CLIP-seq
MIRT920652	hsa-miR-323b-5p	CLIP-seq
MIRT1972825	hsa-miR-330-3p	CLIP-seq
MIRT2512323	hsa-miR-340	CLIP-seq
MIRT920653	hsa-miR-345	CLIP-seq
MIRT2208472	hsa-miR-3613-3p	CLIP-seq
MIRT1547786	hsa-miR-3613-5p	CLIP-seq
MIRT2512324	hsa-miR-3622b-5p	CLIP-seq
MIRT920654	hsa-miR-362-5p	CLIP-seq
MIRT1547789	hsa-miR-363	CLIP-seq
MIRT2428041	hsa-miR-3646	CLIP-seq
MIRT2512325	hsa-miR-3652	CLIP-seq
MIRT1547790	hsa-miR-367	CLIP-seq
MIRT2512326	hsa-miR-3671	CLIP-seq
MIRT2512327	hsa-miR-3673	CLIP-seq
MIRT2512328	hsa-miR-3674	CLIP-seq
MIRT2512329	hsa-miR-3686	CLIP-seq
MIRT920661	hsa-miR-3920	CLIP-seq
MIRT920664	hsa-miR-3977	CLIP-seq
MIRT2436588	hsa-miR-3978	CLIP-seq
MIRT1547792	hsa-miR-409-3p	CLIP-seq
MIRT2512330	hsa-miR-409-5p	CLIP-seq
MIRT920666	hsa-miR-4254	CLIP-seq
MIRT920667	hsa-miR-4256	CLIP-seq
MIRT920668	hsa-miR-4262	CLIP-seq
MIRT920669	hsa-miR-4272	CLIP-seq
MIRT1547793	hsa-miR-4282	CLIP-seq
MIRT920670	hsa-miR-429	CLIP-seq
MIRT2386645	hsa-miR-4309	CLIP-seq
MIRT2386646	hsa-miR-432	CLIP-seq
MIRT2512331	hsa-miR-4320	CLIP-seq
MIRT2512332	hsa-miR-4429	CLIP-seq
MIRT2512333	hsa-miR-4430	CLIP-seq
MIRT2512334	hsa-miR-4453	CLIP-seq
MIRT2512335	hsa-miR-448	CLIP-seq
MIRT2512336	hsa-miR-4503	CLIP-seq
MIRT2512337	hsa-miR-4505	CLIP-seq
MIRT2512338	hsa-miR-4506	CLIP-seq
MIRT1547794	hsa-miR-4528	CLIP-seq
MIRT2512339	hsa-miR-4538	CLIP-seq
MIRT2386647	hsa-miR-4653-3p	CLIP-seq
MIRT2512340	hsa-miR-4659a-5p	CLIP-seq
MIRT2512341	hsa-miR-4659b-5p	CLIP-seq
MIRT2512342	hsa-miR-4666-5p	CLIP-seq
MIRT2512343	hsa-miR-4670-3p	CLIP-seq
MIRT2512344	hsa-miR-4686	CLIP-seq
MIRT2447886	hsa-miR-4690-5p	CLIP-seq
MIRT1547796	hsa-miR-4738-3p	CLIP-seq
MIRT2512345	hsa-miR-4742-3p	CLIP-seq
MIRT920682	hsa-miR-4760-3p	CLIP-seq
MIRT2512346	hsa-miR-4762-3p	CLIP-seq
MIRT920685	hsa-miR-4768-5p	CLIP-seq
MIRT2512347	hsa-miR-4778-5p	CLIP-seq
MIRT2512348	hsa-miR-4781-3p	CLIP-seq
MIRT2512349	hsa-miR-4786-5p	CLIP-seq
MIRT1547797	hsa-miR-4796-5p	CLIP-seq
MIRT1972836	hsa-miR-489	CLIP-seq
MIRT2512350	hsa-miR-490-3p	CLIP-seq
MIRT920687	hsa-miR-499-3p	CLIP-seq
MIRT920688	hsa-miR-499a-3p	CLIP-seq
MIRT920689	hsa-miR-500b	CLIP-seq
MIRT920690	hsa-miR-501-5p	CLIP-seq
MIRT1972837	hsa-miR-511	CLIP-seq
MIRT1972838	hsa-miR-514	CLIP-seq
MIRT1972839	hsa-miR-514b-3p	CLIP-seq
MIRT2512351	hsa-miR-544	CLIP-seq
MIRT920692	hsa-miR-545	CLIP-seq
MIRT920693	hsa-miR-548a-3p	CLIP-seq
MIRT920694	hsa-miR-548a-5p	CLIP-seq
MIRT920695	hsa-miR-548ab	CLIP-seq
MIRT920696	hsa-miR-548ak	CLIP-seq
MIRT920697	hsa-miR-548b-5p	CLIP-seq
MIRT2512352	hsa-miR-548c-3p	CLIP-seq
MIRT920698	hsa-miR-548c-5p	CLIP-seq
MIRT920699	hsa-miR-548d-5p	CLIP-seq
MIRT920700	hsa-miR-548e	CLIP-seq
MIRT920701	hsa-miR-548f	CLIP-seq
MIRT920702	hsa-miR-548h	CLIP-seq
MIRT920703	hsa-miR-548i	CLIP-seq
MIRT920704	hsa-miR-548j	CLIP-seq
MIRT920707	hsa-miR-548n	CLIP-seq
MIRT2512353	hsa-miR-548o	CLIP-seq
MIRT920708	hsa-miR-548p	CLIP-seq
MIRT920709	hsa-miR-548t	CLIP-seq
MIRT920710	hsa-miR-548w	CLIP-seq
MIRT920711	hsa-miR-548y	CLIP-seq
MIRT920712	hsa-miR-559	CLIP-seq
MIRT920713	hsa-miR-583	CLIP-seq
MIRT2512354	hsa-miR-584	CLIP-seq
MIRT920714	hsa-miR-587	CLIP-seq
MIRT2512355	hsa-miR-590-3p	CLIP-seq
MIRT2512356	hsa-miR-605	CLIP-seq
MIRT2512357	hsa-miR-607	CLIP-seq
MIRT920716	hsa-miR-619	CLIP-seq
MIRT2512358	hsa-miR-628-5p	CLIP-seq
MIRT2512359	hsa-miR-633	CLIP-seq
MIRT2512360	hsa-miR-647	CLIP-seq
MIRT2512361	hsa-miR-649	CLIP-seq
MIRT1547807	hsa-miR-656	CLIP-seq
MIRT920718	hsa-miR-664	CLIP-seq
MIRT2512362	hsa-miR-885-5p	CLIP-seq
MIRT1547808	hsa-miR-889	CLIP-seq
MIRT1547810	hsa-miR-92a	CLIP-seq
MIRT1547811	hsa-miR-92b	CLIP-seq
MIRT2512363	hsa-miR-96	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
AHR	Activation	16115918;19287966
AHR	Unknown	12376470;19376845;21742528;24299737
ARNT	Activation	16115918;19287966
ARNT	Unknown	12376470;19255421;19376845;21742528;24299737
BRCA1	Unknown	16567799
EP300	Unknown	20631054
ESR1	Unknown	15126349
KAT2B	Unknown	20631054
SP1	Activation	12801909

Show/Hide all (95)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002930	Process	Trabecular meshwork development	IEA
GO:0002930	Process	Trabecular meshwork development	ISS
GO:0004497	Function	Monooxygenase activity	IDA	15258110, 23821647
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	28620713
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006706	Process	Steroid catabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	IDA	22888116
GO:0006805	Process	Xenobiotic metabolic process	NAS	16982751
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006809	Process	Nitric oxide biosynthetic process	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0008202	Process	Steroid metabolic process	IDA	22888116
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IBA
GO:0008210	Process	Estrogen metabolic process	IDA	11555828, 12865317, 23821647
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008395	Function	Steroid hydroxylase activity	IBA
GO:0008395	Function	Steroid hydroxylase activity	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	ISS
GO:0009404	Process	Toxin metabolic process	IBA
GO:0009404	Process	Toxin metabolic process	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS
GO:0016020	Component	Membrane	IEA
GO:0016125	Process	Sterol metabolic process	TAS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016709	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	TAS
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IDA	10871058
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IDA	15258110
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019373	Process	Epoxygenase P450 pathway	TAS
GO:0020037	Function	Heme binding	IDA	21147782
GO:0020037	Function	Heme binding	IEA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030199	Process	Collagen fibril organization	ISS
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	ISS
GO:0033629	Process	Negative regulation of cell adhesion mediated by integrin	IEA
GO:0033629	Process	Negative regulation of cell adhesion mediated by integrin	ISS
GO:0042178	Process	Xenobiotic catabolic process	IBA
GO:0042445	Process	Hormone metabolic process	IEA
GO:0042537	Process	Benzene-containing compound metabolic process	IEA
GO:0042572	Process	Retinol metabolic process	IDA	10681376, 15258110
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042574	Process	Retinal metabolic process	IDA	15258110
GO:0042574	Process	Retinal metabolic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043542	Process	Endothelial cell migration	IEA
GO:0043542	Process	Endothelial cell migration	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046466	Process	Membrane lipid catabolic process	IEA
GO:0046466	Process	Membrane lipid catabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048514	Process	Blood vessel morphogenesis	ISS
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IEA
GO:0061298	Process	Retina vasculature development in camera-type eye	IEA
GO:0061304	Process	Retinal blood vessel morphogenesis	IEA
GO:0061304	Process	Retinal blood vessel morphogenesis	ISS
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0071603	Process	Endothelial cell-cell adhesion	IEA
GO:0097267	Process	Omega-hydroxylase P450 pathway	TAS
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IDA	11555828
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA
GO:0106256	Function	Hydroperoxy icosatetraenoate dehydratase activity	IEA
GO:0120254	Process	Olefinic compound metabolic process	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	ISS

MIM	HGNC	e!Ensembl
601771	2597	ENSG00000138061

Q16678

Protein name

Cytochrome P450 1B1 (EC 1.14.14.1) (CYPIB1) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152)

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins (PubMed:10681376, PubMed:11555828, PubMed:12865317, PubMed:15258110, PubMed:20972997). Mechanistica

PDB

3PM0 , 6IQ5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	51 → 520	Cytochrome P450	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, lung, skeletal muscle, kidney, spleen, thymus, prostate, testis, ovary, small intestine, colon, and peripheral blood leukocytes (PubMed:8175734). Expressed in retinal endothelial cells and umbilical vein endo

Sequence

MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ

Sequence length

543

Interactions

View interactions

	KEGG		Reactome
	Steroid hormone biosynthesis Tryptophan metabolism Metabolism of xenobiotics by cytochrome P450 Ovarian steroidogenesis Chemical carcinogenesis - DNA adducts MicroRNAs in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species		Endogenous sterols Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) Defective CYP1B1 causes Glaucoma

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Anterior segment dysgenesis	Likely pathogenic; Pathogenic	rs2465883561, rs72549387, rs587778873, rs72549376	RCV002471918 RCV001200036 RCV001200040 RCV001200037	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Anterior segment dysgenesis 6	Likely pathogenic; Pathogenic	rs104894979, rs778202993, rs2125316235, rs529769268, rs2125314883, rs56175199, rs72481807, rs777515179, rs768047511, rs72466462, rs72549379, rs765666893, rs72549381, rs72549388, rs72480442 View all (47 more)	RCV003466995 RCV003469772 RCV001449671 RCV002506646 RCV002501938 View all (60 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital glaucoma	Likely pathogenic; Pathogenic	rs778202993, rs757520959, rs56175199, rs72549373, rs777515179, rs72549379, rs765666893, rs72549381, rs72549388, rs72480442, rs148542782, rs2465882994, rs1373671407, rs1450783755, rs28936700 View all (38 more)	RCV001390416 RCV005094805 RCV003594146 RCV003759361 RCV001885179 View all (51 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital ocular coloboma	Pathogenic	rs587778875	RCV000059339	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
CYP1B1-related disorder	Pathogenic	rs28936700, rs28936701, rs55989760, rs72549387, rs72549380, rs377049098, rs771076928, rs587778873, rs587778875	RCV004732534 RCV004732535 RCV004732536 RCV000331073 RCV004535284 View all (4 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CYP1B1-related glaucoma with or without anterior segment dysgenesis	Likely pathogenic; Pathogenic	rs104894979, rs2125316235, rs56175199, rs72481807, rs768047511, rs72466462, rs2125316074, rs1389588817, rs72549379, rs72549381, rs72480442, rs148542782, rs28936700, rs55771538, rs28936701 View all (14 more)	RCV006255149 RCV006255196 RCV006255198 RCV006255200 RCV006255202 View all (25 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glaucoma 3, primary infantile, B	Likely pathogenic; Pathogenic	rs529769268, rs2125314883, rs72481807, rs28936700, rs72549387, rs766425037, rs771076928, rs751768343	RCV002506646 RCV002501938 RCV002503262 RCV005357093 RCV000763084 RCV002503968 RCV002491346 RCV002505536 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glaucoma 3A	Likely pathogenic; Pathogenic	rs104894979, rs906925939, rs778202993, rs2125316235, rs529769268, rs2125314883, rs56175199, rs72481807, rs768047511, rs2125316074, rs1389588817, rs72549379, rs72549388, rs72480442, rs770799584 View all (32 more)	RCV000082861 RCV001376149 RCV005023153 RCV001449672 RCV002506646 View all (44 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glaucoma of childhood	Pathogenic	rs55989760	RCV000791358	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma, primary open angle, juvenile-onset	Pathogenic; Likely pathogenic	rs2125316417, rs104893629	RCV000008181 RCV000008183	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Irido-corneo-trabecular dysgenesis	Pathogenic	rs72549387, rs1064792896, rs587778873	RCV000008176 RCV000477808 RCV000059336	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary congenital glaucoma	Likely pathogenic; Pathogenic	rs529769268, rs757520959, rs777515179, rs2125316074, rs72549379, rs765666893, rs72549381, rs72480442, rs148542782, rs2465882994, rs28936700, rs28936701, rs55989760, rs72549389, rs104893628 View all (12 more)	RCV001526885 RCV002509687 RCV004801049 RCV003331212 RCV001825056 View all (23 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (38)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANTERIOR SEGMENT MESENCHYMAL DYSGENESIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA 1, OPEN ANGLE, A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA 3, PRIMARY CONGENITAL, A	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, early-onset, digenic	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROPHTHALMOS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE GLAUCOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy, centronuclear, 5	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary open angle glaucoma	Likely benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (345)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23757320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17200336, 18347981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19479063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16002475, 17980933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17363580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	15182955		★★★★★ ★☆☆☆☆ Found in Text Mining only
AL-RAQAD SYNDROME	AL-Raqad Syndrome	BEFREE	23922489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24704000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	23422825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	21306220, 24001018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30299251		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANTERIOR SEGMENT DYSGENESIS 5	Anterior segment dysgenesis	GENOMICS_ENGLAND_DG	12372064, 9497261		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANTERIOR SEGMENT DYSGENESIS 5	Anterior segment dysgenesis	CLINVAR_DG	9097971		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANTERIOR SEGMENT DYSGENESIS 6	Segment dysgenesis	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Anterior segment mesenchymal dysgenesis	Anterior segment mesenchymal dysgenesis	Pubtator	24024747, 27777502, 32224865, 37788597	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior segment mesenchymal dysgenesis	Anterior segment dysgenesis	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior synechiae	Synechiae	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	30299251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	31616008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	435889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26838552	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19575027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36012391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	9850336		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	17106362, 17914928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	17106362, 17914928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17106362, 17914928, 29497932, 31692435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	27777502, 32499604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29497932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	10933049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	31174203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24875910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15122594, 17496311, 18632753, 21990318, 22177211, 23886208, 24358191, 24453031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	25329831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	22859684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	35003394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	21092186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30321868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	30321868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10698474, 11093812, 12010864, 12415427, 12618873, 12844487, 14520706, 14637391, 15072827, 15075793, 15111770, 15157572, 15199113, 15237001, 15386537 View all (55 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037, 17297925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	16808847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10702233, 15237001, 16808847, 17683074, 18212750, 18214058, 18425393, 18628428, 18842620, 19214745, 19293312, 19308726, 19376845, 20037207, 21956102 View all (15 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27956118	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37640964	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	27235555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	14562027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19604582, 22114726, 24358191, 25027399, 26626260, 6511802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28259840, 437913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29060924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23087145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15122594, 17496311, 18632753, 21990318, 22177211, 23886208, 24453031, 26707614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	25299224, 25619313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10739169, 15093676, 15808404, 15896461, 16051642, 17174438, 17496311, 17980933, 1820735, 18409147, 1844821, 18573508, 19174490, 19414505, 20515954 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	31336362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15280921, 25027399, 25860934, 26626260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38183155	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11303589, 15255550, 17372243, 23032576, 25516145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	32533462	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22011756, 28437282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	18977467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23794133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23794133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	15182955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	9783729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22272893, 30665939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Cirrhosis	Pubtator	33978213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	40435780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	24281366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24358191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16006997, 17603900, 17615053, 17627011, 18990750, 19287966, 20701755, 20878130, 21081473, 21490239, 21618522, 22190224, 22459615, 25115775, 27111221, 28714190 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	20878130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17603900, 17615053, 18990750, 20701755, 27111221, 33906313, 36827833, 37059712	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17615053		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	20878130		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	21193517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital glaucoma	Congenital glaucoma	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	24281366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital phimosis	Congenital Phimosis	BEFREE	29080015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29426916, 30381233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21458313, 25027399, 25860934, 26626260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Opacity	Corneal opacity	Pubtator	37788597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29449662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	GWASCAT_DG	30429480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	26838552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	10651994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26975253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	22114726	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	24024747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	33632238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectropion	Ectropion	BEFREE	21306220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	25517428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	23087145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12770747, 12873984, 14656940, 15342454, 18318428, 19690133, 20381444, 20492382, 20887769, 21191305, 22296381, 23370603, 28139960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12770747, 12873984, 14656940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24957043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10724351, 17449539, 17562158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25516145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16530937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16530937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30758105	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23358850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	27977510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	15912477, 27777502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	24281366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	22610071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	27036855		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibroid Tumor	Leiomyoma	LHGDN	18763031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20559649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal fibrosing alopecia	Frontal Fibrosing Alopecia	GWASCAT_DG	30850646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24535777, 24863943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24535777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	38554324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23637977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	23637977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	10851252, 11880716, 14619973, 14635112, 15342693, 15682044, 15733270, 16288197, 17321191, 17914928, 18483560, 19622003, 19643970, 19744731, 20051892 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	10851252, 11774072, 15342693, 15682044, 16288197, 16862072, 17563717, 18483560, 19668597, 20057908, 22876119, 23028769, 25018621, 27243976, 27272408 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	11558822, 12525557, 12567107, 14507861, 14729846, 15255109, 16384942, 16490498, 17164573, 17224759, 17321191, 17591938, 17718864, 18414103, 18470941 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma 1 Open Angle A	Glaucoma	Pubtator	16688110, 19096718, 22878448, 23922489, 29540704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GLAUCOMA 1, OPEN ANGLE, A	Glaucoma	UNIPROT_DG	11774072		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA 1, OPEN ANGLE, D (disorder)	Open Angle Glaucoma	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma 3 Primary Congenital A	Glaucoma	Pubtator	10227395, 10851252, 11774072, 12598442, 15342693, 15475877, 15723004, 16688110, 16735994, 16963504, 17471339, 17591938, 18483560, 18989382, 19096718 View all (46 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GLAUCOMA 3, PRIMARY CONGENITAL, A	Glaucoma	UNIPROT_DG	10227395, 10655546, 11184479, 11527932, 11774072, 11980847, 12036985, 12525557, 14635112, 14640114, 15255109, 15342693, 15475877, 16490498, 16688110 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA 3, PRIMARY CONGENITAL, A	Glaucoma	CLINVAR_DG	11403040, 15037581, 15255109, 18537981, 19643970, 21081970, 21850185, 21854771, 22004014, 27243976, 9097971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA 3, PRIMARY CONGENITAL, A	Glaucoma	GENOMICS_ENGLAND_DG	12372064, 9097971, 9497261		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA 3, PRIMARY CONGENITAL, A	Glaucoma	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA 3, PRIMARY INFANTILE, B	Glaucoma	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
GLAUCOMA 3, PRIMARY INFANTILE, B	Glaucoma	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	23422825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma of childhood	Glaucoma	CLINVAR_DG	10227395, 11403040, 12036985, 12372064, 15342693, 17164573, 17591938, 18227148, 18414103, 18537981, 19234632, 19247456, 19643970, 21081970, 21600657 View all (16 more)		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma of childhood	Glaucoma	BEFREE	11774072, 19668597, 21596299, 21600657, 23218183		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma of childhood	Glaucoma	ORPHANET_DG	19643970, 22878448		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma of childhood	Glaucoma	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glaucoma Open Angle	Open angle glaucoma	Pubtator	11774072, 15342693, 15723004, 16319821, 16688110, 16862072, 17563717, 18385784, 18483560, 19096718, 19643970, 20664688, 21139974, 22876119, 22878448 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	11774072, 18385784, 21730848, 22878448, 24099281, 25950505, 29168043, 29540704, 30484747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	15342693, 16688110, 16862072, 17563717, 18385784, 18483560, 19096718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	15342693, 15723004, 16319821, 16688110, 16862072, 17914928, 18483560, 19643970, 19744731, 19793111, 21139974, 21655360, 22004014, 22509109, 22876119 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
GLAUCOMA, PRIMARY OPEN ANGLE, JUVENILE-ONSET	Open Angle Glaucoma	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioblastoma	Glioblastoma	BEFREE	30321868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35003394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17575219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12107641, 16922636, 18067928, 28556360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	18067928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21205741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29426916, 30381233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	17363580, 17997499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26981862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	28714190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	14562027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	BEFREE	10180507, 11774072, 12807732, 19536304, 19593207, 19668597, 20051892, 20057908, 20151268, 21031026, 21306220, 21596299, 21600657, 23158549, 23218183 View all (13 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydrophthalmos	Glaucoma, congenital	ORPHANET_DG	21730848		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydrophthalmos	Glaucoma, congenital	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperandrogenism	Hyperandrogenism	Pubtator	36368943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31046505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	26647441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22044346, 25304467, 28416584, 30371217, 30923189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	32533462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	29080015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	29080015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20228066	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22859684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31105828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	30899591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irido-corneal dysgenesis	Anterior segment dysgenesis	BEFREE	17106362, 24001018, 28644236, 30457409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	ORPHANET_DG	11403040, 15621878, 16735991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	BEFREE	15682044, 16638984, 16735991, 21600657, 24024747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile glaucoma	Glaucoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	25027399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	15041720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	25027399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25299224, 6511802	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25299224, 25619313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Late onset congenital glaucoma	Congenital glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17496311, 25992585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17496311, 36193313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25992585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25992585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	24704000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	19138996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31514003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19064581, 24614526, 25796598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23087145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	23087145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24614526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	19754948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	11376689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	12584184, 28858732		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	17980933, 18573508		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	19174490, 2232364, 24657910, 33283556, 36128170, 36193313	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	6511802	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33692504	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12584184		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16985026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	16985026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	28714190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12107641, 16922636, 18067928, 28556360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of lower limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of upper limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10698474, 11093812, 12010864, 12415427, 12618873, 12844487, 14520706, 14637391, 15072827, 15075793, 15111770, 15157572, 15199113, 15237001, 15386537 View all (55 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037, 17297925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12770747, 12873984, 14656940, 15342454, 18318428, 20381444, 20492382, 20887769, 21191305, 22296381, 23370603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16530937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24535777, 24863943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	15041720, 21458313, 24913727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	16331346, 25299224, 25619313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23087145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10739169, 15093676, 15808404, 15896461, 16051642, 17174438, 17496311, 17980933, 1820735, 18409147, 1844821, 18573508, 19174490, 19414505, 20515954 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	22114726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11303589, 12584184, 15255550, 17372243, 23032576, 25516145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	17372243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18347981, 19895167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11891538, 12200121, 14562027, 15330195, 15374634, 16115918, 16172228, 16569655, 17704407, 18187806, 18544568, 18657896, 19505920, 19820397, 22327650 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17704407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15122594, 17496311, 18632753, 21990318, 22177211, 23886208, 24453031, 26707614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12107641, 12869499, 12872524, 15374634, 15958627, 16115918, 16547151, 19116217, 19730035, 20830506, 22272893, 22561558, 23886208, 24358191, 24453031 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	11389067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23794133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037, 17297925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14734460, 16847423, 17077994, 17224914, 17311112, 17458695, 17507616, 17919675, 17922187, 18425393, 18628428, 19138946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037, 17297925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17922187, 19083124, 7589551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037, 17297925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15182955		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	16598069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	16598069	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	16598069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24684199, 28322972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	40528211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18657896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	24281366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	24281366, 27777502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	16978616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	22114726		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	32887903, 6511802	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	19736056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19736056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31181469		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10910056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19730035, 30381233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11461084, 14703066, 14720319, 15958627, 16002475, 16172228, 16547151, 16730930, 16847423, 17507616, 17548691, 18059014, 18214058, 18262049, 18347981 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30321868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	25051309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	24704000		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Primary adult open-angle glaucoma	Open Angle Glaucoma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20845989, 25504507, 27495872, 27922681, 28000861, 28377924, 28858732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17997499, 24684199, 28583802, 28821316, 30989560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	27036855		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular Hypertension	BEFREE	16862072, 23922489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	16862072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculo-dento-digital syndrome	Oculodentodigital dysplasia	BEFREE	16638984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	15734954, 26458823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	20357201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	18977467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	18977467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11303589, 15255550, 17372243, 23032576, 25516145		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15255550, 17372243		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	17372243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11461084, 24961659, 31493422, 39395328	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	23776235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18347981, 19895167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	18347981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22301281	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	11376689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31559607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	18347981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	29080015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31286538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	30321868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	23283740, 26975253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26975253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior synechiae	Synechiae	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Postmenopausal frontal fibrosing alopecia	Frontal fibrosing alopecia	GWASCAT_DG	30850646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23757320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	21894172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	23422825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary congenital glaucoma	Congenital glaucoma	BEFREE	10227395, 10511040, 10655546, 11026969, 11239867, 11527932, 11740343, 11980847, 12036985, 12372064, 12567107, 14507861, 14635112, 15037581, 15255109 View all (82 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primary congenital glaucoma	Congenital glaucoma	GENOMICS_ENGLAND_DG	12372064, 9497261		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primary congenital glaucoma	Congenital glaucoma	HPO_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Prostate cancer familial	Prostate cancer	Pubtator	14562027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	14562027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11891538, 12200121, 14562027, 15330195, 15374634, 16115918, 16172228, 16569655, 17704407, 18187806, 18544568, 18657896, 19505920, 19820397, 22327650 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12200121, 16115918, 18187806, 18544568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14562027, 15330195, 18544568, 20875115, 22549291, 27164191, 27399092, 27513235, 30133114, 31493422, 35292057, 35638715	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17704407		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26981862, 28388569		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	19357154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22859684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30665939, 32158203, 34820703, 36012391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15041720, 21458313, 25027399, 25860934, 26626260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27235555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Artery Occlusion	Retinal Artery Occlusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	19005183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinol Deficiency	Retinol Deficiency	BEFREE	28583802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger eye malformation sequence	Axenfeld anomaly	BEFREE	16735994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rieger syndrome	Rieger syndrome	BEFREE	16735994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	10651994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11389067, 19479063, 22114726, 9783729		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	CTD_human_DG	22114726		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19138996, 29629838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22114726	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20568895, 21205741, 24343338, 24519899, 27894333, 28556360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	27036855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18158559, 37783717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sturge-Weber Syndrome	Sturge-Weber Syndrome	BEFREE	20051892		★★★★★ ★☆☆☆☆ Found in Text Mining only
STUVE-WIEDEMANN SYNDROME	Stuve-Wiedemann syndrome	BEFREE	20051892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcapsular cataract	Subcapsular cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	27111221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporal pallor of optic disc	Temporal Pallor Of Optic Disc	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	15237001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33906328, 34326372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	24358191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21990318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23886208, 24358191, 33692504, 40528211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19755661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23794133, 32975231, 38376298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	18763031, 20559649, 24777039, 26482777, 30989560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	16319821, 25950505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	30042310		★★★★★ ★☆☆☆☆ Found in Text Mining only

CYP1B1 (cytochrome P450 family 1 subfamily B member 1)