Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1544
Gene name	Cytochrome P450 family 1 subfamily A member 2
Gene symbol	CYP1A2
Synonyms (NCBI Gene)	CP12CYPIA2P3-450P450(PA)
Chromosome	15
Chromosome location	15q24.1
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encode

440

Show/Hide all (440)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052168	hsa-let-7b-5p	CLASH	23622248
MIRT619678	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT619677	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619676	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT619675	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT619674	hsa-miR-8073	HITS-CLIP	23824327
MIRT619673	hsa-miR-1292-3p	HITS-CLIP	23824327
MIRT619672	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT619671	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT619670	hsa-miR-3128	HITS-CLIP	23824327
MIRT619669	hsa-miR-4252	HITS-CLIP	23824327
MIRT619668	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT619667	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT619666	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT619665	hsa-miR-7703	HITS-CLIP	23824327
MIRT619678	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT619677	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT619676	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT619675	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT619674	hsa-miR-8073	HITS-CLIP	23824327
MIRT619673	hsa-miR-1292-3p	HITS-CLIP	23824327
MIRT619672	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT619671	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT619670	hsa-miR-3128	HITS-CLIP	23824327
MIRT619669	hsa-miR-4252	HITS-CLIP	23824327
MIRT619668	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT619667	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT619666	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT619665	hsa-miR-7703	HITS-CLIP	23824327
MIRT920553	hsa-miR-1202	CLIP-seq
MIRT920554	hsa-miR-1228	CLIP-seq
MIRT920555	hsa-miR-1261	CLIP-seq
MIRT920556	hsa-miR-1273f	CLIP-seq
MIRT920557	hsa-miR-1287	CLIP-seq
MIRT920558	hsa-miR-1322	CLIP-seq
MIRT920559	hsa-miR-138	CLIP-seq
MIRT920560	hsa-miR-143	CLIP-seq
MIRT920561	hsa-miR-1827	CLIP-seq
MIRT920562	hsa-miR-1909	CLIP-seq
MIRT920563	hsa-miR-24	CLIP-seq
MIRT920564	hsa-miR-2909	CLIP-seq
MIRT920565	hsa-miR-3120-5p	CLIP-seq
MIRT920566	hsa-miR-3125	CLIP-seq
MIRT920567	hsa-miR-3165	CLIP-seq
MIRT920568	hsa-miR-3170	CLIP-seq
MIRT920569	hsa-miR-3187-3p	CLIP-seq
MIRT920570	hsa-miR-342-3p	CLIP-seq
MIRT920571	hsa-miR-3613-3p	CLIP-seq
MIRT920572	hsa-miR-3647-3p	CLIP-seq
MIRT920573	hsa-miR-3652	CLIP-seq
MIRT920574	hsa-miR-3664-5p	CLIP-seq
MIRT920575	hsa-miR-3665	CLIP-seq
MIRT920576	hsa-miR-3714	CLIP-seq
MIRT920577	hsa-miR-371-5p	CLIP-seq
MIRT920578	hsa-miR-371b-5p	CLIP-seq
MIRT920579	hsa-miR-3916	CLIP-seq
MIRT920580	hsa-miR-3926	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT920582	hsa-miR-3972	CLIP-seq
MIRT920583	hsa-miR-4266	CLIP-seq
MIRT920584	hsa-miR-4267	CLIP-seq
MIRT920585	hsa-miR-4274	CLIP-seq
MIRT920586	hsa-miR-4278	CLIP-seq
MIRT920587	hsa-miR-4284	CLIP-seq
MIRT920588	hsa-miR-4299	CLIP-seq
MIRT920589	hsa-miR-4316	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920591	hsa-miR-4430	CLIP-seq
MIRT920592	hsa-miR-4432	CLIP-seq
MIRT920593	hsa-miR-4433	CLIP-seq
MIRT920594	hsa-miR-4446-3p	CLIP-seq
MIRT920595	hsa-miR-4459	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT920597	hsa-miR-4492	CLIP-seq
MIRT920598	hsa-miR-4498	CLIP-seq
MIRT920599	hsa-miR-4506	CLIP-seq
MIRT920600	hsa-miR-4519	CLIP-seq
MIRT920601	hsa-miR-4522	CLIP-seq
MIRT920602	hsa-miR-4529-5p	CLIP-seq
MIRT920603	hsa-miR-4684-5p	CLIP-seq
MIRT920604	hsa-miR-4685-5p	CLIP-seq
MIRT920605	hsa-miR-4708-5p	CLIP-seq
MIRT920606	hsa-miR-4710	CLIP-seq
MIRT920607	hsa-miR-4722-5p	CLIP-seq
MIRT920608	hsa-miR-4736	CLIP-seq
MIRT920609	hsa-miR-4755-3p	CLIP-seq
MIRT920610	hsa-miR-4764-5p	CLIP-seq
MIRT920611	hsa-miR-4768-3p	CLIP-seq
MIRT920612	hsa-miR-4770	CLIP-seq
MIRT920613	hsa-miR-4792	CLIP-seq
MIRT920614	hsa-miR-4797-5p	CLIP-seq
MIRT920615	hsa-miR-4799-5p	CLIP-seq
MIRT920616	hsa-miR-499-5p	CLIP-seq
MIRT920617	hsa-miR-548a-3p	CLIP-seq
MIRT920618	hsa-miR-548c-3p	CLIP-seq
MIRT920619	hsa-miR-548e	CLIP-seq
MIRT920620	hsa-miR-548f	CLIP-seq
MIRT920621	hsa-miR-548s	CLIP-seq
MIRT920622	hsa-miR-615-5p	CLIP-seq
MIRT920623	hsa-miR-7	CLIP-seq
MIRT920624	hsa-miR-762	CLIP-seq
MIRT920625	hsa-miR-766	CLIP-seq
MIRT920626	hsa-miR-940	CLIP-seq
MIRT920556	hsa-miR-1273f	CLIP-seq
MIRT920560	hsa-miR-143	CLIP-seq
MIRT920561	hsa-miR-1827	CLIP-seq
MIRT1547758	hsa-miR-2467-3p	CLIP-seq
MIRT1547759	hsa-miR-3160-3p	CLIP-seq
MIRT1547760	hsa-miR-3192	CLIP-seq
MIRT1547761	hsa-miR-3612	CLIP-seq
MIRT1547762	hsa-miR-3689a-3p	CLIP-seq
MIRT1547763	hsa-miR-3689c	CLIP-seq
MIRT1547764	hsa-miR-4257	CLIP-seq
MIRT1547765	hsa-miR-4487	CLIP-seq
MIRT920605	hsa-miR-4708-5p	CLIP-seq
MIRT1547766	hsa-miR-4728-5p	CLIP-seq
MIRT920612	hsa-miR-4770	CLIP-seq
MIRT1547767	hsa-miR-490-3p	CLIP-seq
MIRT1547768	hsa-miR-558	CLIP-seq
MIRT1547769	hsa-miR-650	CLIP-seq
MIRT920553	hsa-miR-1202	CLIP-seq
MIRT920554	hsa-miR-1228	CLIP-seq
MIRT1972786	hsa-miR-1262	CLIP-seq
MIRT920556	hsa-miR-1273f	CLIP-seq
MIRT1972787	hsa-miR-129-5p	CLIP-seq
MIRT920558	hsa-miR-1322	CLIP-seq
MIRT920560	hsa-miR-143	CLIP-seq
MIRT920561	hsa-miR-1827	CLIP-seq
MIRT1972788	hsa-miR-193a-5p	CLIP-seq
MIRT1972789	hsa-miR-2114	CLIP-seq
MIRT1972790	hsa-miR-2467-5p	CLIP-seq
MIRT1972791	hsa-miR-3122	CLIP-seq
MIRT1972792	hsa-miR-3135b	CLIP-seq
MIRT1972793	hsa-miR-3188	CLIP-seq
MIRT1972794	hsa-miR-3194-5p	CLIP-seq
MIRT1972795	hsa-miR-323-5p	CLIP-seq
MIRT1547761	hsa-miR-3612	CLIP-seq
MIRT1972796	hsa-miR-3616-5p	CLIP-seq
MIRT1972797	hsa-miR-3647-5p	CLIP-seq
MIRT1972798	hsa-miR-365	CLIP-seq
MIRT1972799	hsa-miR-3650	CLIP-seq
MIRT920573	hsa-miR-3652	CLIP-seq
MIRT1547762	hsa-miR-3689a-3p	CLIP-seq
MIRT1547763	hsa-miR-3689c	CLIP-seq
MIRT1972800	hsa-miR-3913-5p	CLIP-seq
MIRT920580	hsa-miR-3926	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT920582	hsa-miR-3972	CLIP-seq
MIRT1972801	hsa-miR-3975	CLIP-seq
MIRT920588	hsa-miR-4299	CLIP-seq
MIRT1972802	hsa-miR-431	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920591	hsa-miR-4430	CLIP-seq
MIRT920592	hsa-miR-4432	CLIP-seq
MIRT1972803	hsa-miR-4474-5p	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT1972804	hsa-miR-4494	CLIP-seq
MIRT1972805	hsa-miR-4499	CLIP-seq
MIRT1972806	hsa-miR-4649-3p	CLIP-seq
MIRT1972807	hsa-miR-4662a-5p	CLIP-seq
MIRT1972808	hsa-miR-4676-5p	CLIP-seq
MIRT920603	hsa-miR-4684-5p	CLIP-seq
MIRT1972809	hsa-miR-4701-3p	CLIP-seq
MIRT920605	hsa-miR-4708-5p	CLIP-seq
MIRT920607	hsa-miR-4722-5p	CLIP-seq
MIRT1547766	hsa-miR-4728-5p	CLIP-seq
MIRT920609	hsa-miR-4755-3p	CLIP-seq
MIRT920611	hsa-miR-4768-3p	CLIP-seq
MIRT920612	hsa-miR-4770	CLIP-seq
MIRT1972810	hsa-miR-4795-5p	CLIP-seq
MIRT920614	hsa-miR-4797-5p	CLIP-seq
MIRT1972811	hsa-miR-485-5p	CLIP-seq
MIRT1547767	hsa-miR-490-3p	CLIP-seq
MIRT920616	hsa-miR-499-5p	CLIP-seq
MIRT1972812	hsa-miR-542-3p	CLIP-seq
MIRT920618	hsa-miR-548c-3p	CLIP-seq
MIRT920621	hsa-miR-548s	CLIP-seq
MIRT1972813	hsa-miR-550a	CLIP-seq
MIRT1972814	hsa-miR-573	CLIP-seq
MIRT1972815	hsa-miR-575	CLIP-seq
MIRT920622	hsa-miR-615-5p	CLIP-seq
MIRT1972816	hsa-miR-636	CLIP-seq
MIRT1547769	hsa-miR-650	CLIP-seq
MIRT920625	hsa-miR-766	CLIP-seq
MIRT1972817	hsa-miR-876-3p	CLIP-seq
MIRT1972818	hsa-miR-890	CLIP-seq
MIRT920626	hsa-miR-940	CLIP-seq
MIRT2208455	hsa-miR-1207-5p	CLIP-seq
MIRT1972786	hsa-miR-1262	CLIP-seq
MIRT920556	hsa-miR-1273f	CLIP-seq
MIRT920558	hsa-miR-1322	CLIP-seq
MIRT920559	hsa-miR-138	CLIP-seq
MIRT2208456	hsa-miR-142-3p	CLIP-seq
MIRT920560	hsa-miR-143	CLIP-seq
MIRT920561	hsa-miR-1827	CLIP-seq
MIRT920562	hsa-miR-1909	CLIP-seq
MIRT2208457	hsa-miR-2053	CLIP-seq
MIRT1972789	hsa-miR-2114	CLIP-seq
MIRT1547758	hsa-miR-2467-3p	CLIP-seq
MIRT1972790	hsa-miR-2467-5p	CLIP-seq
MIRT1972791	hsa-miR-3122	CLIP-seq
MIRT1972792	hsa-miR-3135b	CLIP-seq
MIRT2208458	hsa-miR-3145-5p	CLIP-seq
MIRT1547759	hsa-miR-3160-3p	CLIP-seq
MIRT920567	hsa-miR-3165	CLIP-seq
MIRT2208459	hsa-miR-3174	CLIP-seq
MIRT1972793	hsa-miR-3188	CLIP-seq
MIRT1547760	hsa-miR-3192	CLIP-seq
MIRT2208460	hsa-miR-3197	CLIP-seq
MIRT1547761	hsa-miR-3612	CLIP-seq
MIRT1972799	hsa-miR-3650	CLIP-seq
MIRT920573	hsa-miR-3652	CLIP-seq
MIRT2208461	hsa-miR-3656	CLIP-seq
MIRT1547762	hsa-miR-3689a-3p	CLIP-seq
MIRT1547763	hsa-miR-3689c	CLIP-seq
MIRT1972800	hsa-miR-3913-5p	CLIP-seq
MIRT920580	hsa-miR-3926	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT1972801	hsa-miR-3975	CLIP-seq
MIRT1547764	hsa-miR-4257	CLIP-seq
MIRT920588	hsa-miR-4299	CLIP-seq
MIRT920589	hsa-miR-4316	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920591	hsa-miR-4430	CLIP-seq
MIRT2208462	hsa-miR-4434	CLIP-seq
MIRT1972803	hsa-miR-4474-5p	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT1547765	hsa-miR-4487	CLIP-seq
MIRT1972804	hsa-miR-4494	CLIP-seq
MIRT1972805	hsa-miR-4499	CLIP-seq
MIRT2208463	hsa-miR-4516	CLIP-seq
MIRT2208464	hsa-miR-4531	CLIP-seq
MIRT1972806	hsa-miR-4649-3p	CLIP-seq
MIRT1972809	hsa-miR-4701-3p	CLIP-seq
MIRT920605	hsa-miR-4708-5p	CLIP-seq
MIRT920606	hsa-miR-4710	CLIP-seq
MIRT920607	hsa-miR-4722-5p	CLIP-seq
MIRT1547766	hsa-miR-4728-5p	CLIP-seq
MIRT2208465	hsa-miR-4763-3p	CLIP-seq
MIRT920611	hsa-miR-4768-3p	CLIP-seq
MIRT920612	hsa-miR-4770	CLIP-seq
MIRT920613	hsa-miR-4792	CLIP-seq
MIRT920614	hsa-miR-4797-5p	CLIP-seq
MIRT1972811	hsa-miR-485-5p	CLIP-seq
MIRT1547767	hsa-miR-490-3p	CLIP-seq
MIRT1972812	hsa-miR-542-3p	CLIP-seq
MIRT920621	hsa-miR-548s	CLIP-seq
MIRT1972813	hsa-miR-550a	CLIP-seq
MIRT1547768	hsa-miR-558	CLIP-seq
MIRT2208466	hsa-miR-569	CLIP-seq
MIRT920622	hsa-miR-615-5p	CLIP-seq
MIRT1547769	hsa-miR-650	CLIP-seq
MIRT2208467	hsa-miR-658	CLIP-seq
MIRT2208468	hsa-miR-668	CLIP-seq
MIRT920625	hsa-miR-766	CLIP-seq
MIRT1972818	hsa-miR-890	CLIP-seq
MIRT2208469	hsa-miR-921	CLIP-seq
MIRT920626	hsa-miR-940	CLIP-seq
MIRT920554	hsa-miR-1228	CLIP-seq
MIRT920555	hsa-miR-1261	CLIP-seq
MIRT920556	hsa-miR-1273f	CLIP-seq
MIRT920558	hsa-miR-1322	CLIP-seq
MIRT920560	hsa-miR-143	CLIP-seq
MIRT920561	hsa-miR-1827	CLIP-seq
MIRT2386641	hsa-miR-1915	CLIP-seq
MIRT1972789	hsa-miR-2114	CLIP-seq
MIRT1547758	hsa-miR-2467-3p	CLIP-seq
MIRT1972790	hsa-miR-2467-5p	CLIP-seq
MIRT1972791	hsa-miR-3122	CLIP-seq
MIRT2208458	hsa-miR-3145-5p	CLIP-seq
MIRT1547759	hsa-miR-3160-3p	CLIP-seq
MIRT1972793	hsa-miR-3188	CLIP-seq
MIRT1547760	hsa-miR-3192	CLIP-seq
MIRT1547761	hsa-miR-3612	CLIP-seq
MIRT1972799	hsa-miR-3650	CLIP-seq
MIRT1547762	hsa-miR-3689a-3p	CLIP-seq
MIRT1547763	hsa-miR-3689c	CLIP-seq
MIRT1972800	hsa-miR-3913-5p	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT1972801	hsa-miR-3975	CLIP-seq
MIRT1547764	hsa-miR-4257	CLIP-seq
MIRT920586	hsa-miR-4278	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920593	hsa-miR-4433	CLIP-seq
MIRT920595	hsa-miR-4459	CLIP-seq
MIRT1972803	hsa-miR-4474-5p	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT1547765	hsa-miR-4487	CLIP-seq
MIRT1972806	hsa-miR-4649-3p	CLIP-seq
MIRT920605	hsa-miR-4708-5p	CLIP-seq
MIRT920607	hsa-miR-4722-5p	CLIP-seq
MIRT2386642	hsa-miR-4726-3p	CLIP-seq
MIRT1547766	hsa-miR-4728-5p	CLIP-seq
MIRT2386643	hsa-miR-4747-5p	CLIP-seq
MIRT920611	hsa-miR-4768-3p	CLIP-seq
MIRT920612	hsa-miR-4770	CLIP-seq
MIRT1972811	hsa-miR-485-5p	CLIP-seq
MIRT1547767	hsa-miR-490-3p	CLIP-seq
MIRT1972813	hsa-miR-550a	CLIP-seq
MIRT1547768	hsa-miR-558	CLIP-seq
MIRT1547769	hsa-miR-650	CLIP-seq
MIRT1972818	hsa-miR-890	CLIP-seq
MIRT920626	hsa-miR-940	CLIP-seq
MIRT1972789	hsa-miR-2114	CLIP-seq
MIRT920565	hsa-miR-3120-5p	CLIP-seq
MIRT2447884	hsa-miR-3150a-5p	CLIP-seq
MIRT2447885	hsa-miR-3150b-5p	CLIP-seq
MIRT1972795	hsa-miR-323-5p	CLIP-seq
MIRT920571	hsa-miR-3613-3p	CLIP-seq
MIRT1972799	hsa-miR-3650	CLIP-seq
MIRT920574	hsa-miR-3664-5p	CLIP-seq
MIRT920577	hsa-miR-371-5p	CLIP-seq
MIRT920578	hsa-miR-371b-5p	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920592	hsa-miR-4432	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT920601	hsa-miR-4522	CLIP-seq
MIRT1972807	hsa-miR-4662a-5p	CLIP-seq
MIRT1972808	hsa-miR-4676-5p	CLIP-seq
MIRT920603	hsa-miR-4684-5p	CLIP-seq
MIRT920609	hsa-miR-4755-3p	CLIP-seq
MIRT920614	hsa-miR-4797-5p	CLIP-seq
MIRT1972811	hsa-miR-485-5p	CLIP-seq
MIRT920618	hsa-miR-548c-3p	CLIP-seq
MIRT1972815	hsa-miR-575	CLIP-seq
MIRT920625	hsa-miR-766	CLIP-seq
MIRT1972817	hsa-miR-876-3p	CLIP-seq
MIRT1972789	hsa-miR-2114	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT1972807	hsa-miR-4662a-5p	CLIP-seq
MIRT1972808	hsa-miR-4676-5p	CLIP-seq
MIRT920603	hsa-miR-4684-5p	CLIP-seq
MIRT920609	hsa-miR-4755-3p	CLIP-seq
MIRT1972811	hsa-miR-485-5p	CLIP-seq
MIRT920618	hsa-miR-548c-3p	CLIP-seq
MIRT1972815	hsa-miR-575	CLIP-seq
MIRT920554	hsa-miR-1228	CLIP-seq
MIRT2512295	hsa-miR-128	CLIP-seq
MIRT920561	hsa-miR-1827	CLIP-seq
MIRT2386641	hsa-miR-1915	CLIP-seq
MIRT2208457	hsa-miR-2053	CLIP-seq
MIRT1972789	hsa-miR-2114	CLIP-seq
MIRT920565	hsa-miR-3120-5p	CLIP-seq
MIRT1972791	hsa-miR-3122	CLIP-seq
MIRT2447884	hsa-miR-3150a-5p	CLIP-seq
MIRT2447885	hsa-miR-3150b-5p	CLIP-seq
MIRT920569	hsa-miR-3187-3p	CLIP-seq
MIRT1972795	hsa-miR-323-5p	CLIP-seq
MIRT920571	hsa-miR-3613-3p	CLIP-seq
MIRT1972799	hsa-miR-3650	CLIP-seq
MIRT920574	hsa-miR-3664-5p	CLIP-seq
MIRT1547762	hsa-miR-3689a-3p	CLIP-seq
MIRT1547763	hsa-miR-3689c	CLIP-seq
MIRT920577	hsa-miR-371-5p	CLIP-seq
MIRT920578	hsa-miR-371b-5p	CLIP-seq
MIRT1972800	hsa-miR-3913-5p	CLIP-seq
MIRT920580	hsa-miR-3926	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920592	hsa-miR-4432	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT920601	hsa-miR-4522	CLIP-seq
MIRT920602	hsa-miR-4529-5p	CLIP-seq
MIRT1972806	hsa-miR-4649-3p	CLIP-seq
MIRT1972807	hsa-miR-4662a-5p	CLIP-seq
MIRT1972808	hsa-miR-4676-5p	CLIP-seq
MIRT920603	hsa-miR-4684-5p	CLIP-seq
MIRT920607	hsa-miR-4722-5p	CLIP-seq
MIRT2386642	hsa-miR-4726-3p	CLIP-seq
MIRT1547766	hsa-miR-4728-5p	CLIP-seq
MIRT2386643	hsa-miR-4747-5p	CLIP-seq
MIRT920609	hsa-miR-4755-3p	CLIP-seq
MIRT920611	hsa-miR-4768-3p	CLIP-seq
MIRT2512296	hsa-miR-4786-5p	CLIP-seq
MIRT2512297	hsa-miR-4793-5p	CLIP-seq
MIRT920614	hsa-miR-4797-5p	CLIP-seq
MIRT1972811	hsa-miR-485-5p	CLIP-seq
MIRT920616	hsa-miR-499-5p	CLIP-seq
MIRT920617	hsa-miR-548a-3p	CLIP-seq
MIRT920618	hsa-miR-548c-3p	CLIP-seq
MIRT920619	hsa-miR-548e	CLIP-seq
MIRT920620	hsa-miR-548f	CLIP-seq
MIRT920621	hsa-miR-548s	CLIP-seq
MIRT1972813	hsa-miR-550a	CLIP-seq
MIRT2208466	hsa-miR-569	CLIP-seq
MIRT1972815	hsa-miR-575	CLIP-seq
MIRT2512298	hsa-miR-671-5p	CLIP-seq
MIRT920625	hsa-miR-766	CLIP-seq
MIRT1972817	hsa-miR-876-3p	CLIP-seq
MIRT920626	hsa-miR-940	CLIP-seq
MIRT2512295	hsa-miR-128	CLIP-seq
MIRT920561	hsa-miR-1827	CLIP-seq
MIRT2208457	hsa-miR-2053	CLIP-seq
MIRT1972789	hsa-miR-2114	CLIP-seq
MIRT920565	hsa-miR-3120-5p	CLIP-seq
MIRT1972791	hsa-miR-3122	CLIP-seq
MIRT2447884	hsa-miR-3150a-5p	CLIP-seq
MIRT2447885	hsa-miR-3150b-5p	CLIP-seq
MIRT2208460	hsa-miR-3197	CLIP-seq
MIRT1972795	hsa-miR-323-5p	CLIP-seq
MIRT920571	hsa-miR-3613-3p	CLIP-seq
MIRT1972799	hsa-miR-3650	CLIP-seq
MIRT2208461	hsa-miR-3656	CLIP-seq
MIRT920574	hsa-miR-3664-5p	CLIP-seq
MIRT1547762	hsa-miR-3689a-3p	CLIP-seq
MIRT1547763	hsa-miR-3689c	CLIP-seq
MIRT920577	hsa-miR-371-5p	CLIP-seq
MIRT920578	hsa-miR-371b-5p	CLIP-seq
MIRT1972800	hsa-miR-3913-5p	CLIP-seq
MIRT920580	hsa-miR-3926	CLIP-seq
MIRT920581	hsa-miR-3929	CLIP-seq
MIRT920590	hsa-miR-4419b	CLIP-seq
MIRT920592	hsa-miR-4432	CLIP-seq
MIRT920596	hsa-miR-4478	CLIP-seq
MIRT920601	hsa-miR-4522	CLIP-seq
MIRT1972806	hsa-miR-4649-3p	CLIP-seq
MIRT1972807	hsa-miR-4662a-5p	CLIP-seq
MIRT1972808	hsa-miR-4676-5p	CLIP-seq
MIRT920603	hsa-miR-4684-5p	CLIP-seq
MIRT920607	hsa-miR-4722-5p	CLIP-seq
MIRT1547766	hsa-miR-4728-5p	CLIP-seq
MIRT920609	hsa-miR-4755-3p	CLIP-seq
MIRT2512296	hsa-miR-4786-5p	CLIP-seq
MIRT2512297	hsa-miR-4793-5p	CLIP-seq
MIRT920614	hsa-miR-4797-5p	CLIP-seq
MIRT1972811	hsa-miR-485-5p	CLIP-seq
MIRT920616	hsa-miR-499-5p	CLIP-seq
MIRT920617	hsa-miR-548a-3p	CLIP-seq
MIRT920618	hsa-miR-548c-3p	CLIP-seq
MIRT920619	hsa-miR-548e	CLIP-seq
MIRT920620	hsa-miR-548f	CLIP-seq
MIRT920621	hsa-miR-548s	CLIP-seq
MIRT2208466	hsa-miR-569	CLIP-seq
MIRT1972815	hsa-miR-575	CLIP-seq
MIRT920625	hsa-miR-766	CLIP-seq
MIRT1972817	hsa-miR-876-3p	CLIP-seq
MIRT920626	hsa-miR-940	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
AHR	Unknown	21357676
FOS	Unknown	12135113
HNF1A	Unknown	7723729
JUN	Unknown	12135113

Show/Hide all (70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IDA	15327587, 19651758
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	26988023, 32296183
GO:0005739	Component	Mitochondrion	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006706	Process	Steroid catabolic process	IBA
GO:0006706	Process	Steroid catabolic process	IMP	18356043
GO:0006778	Process	Porphyrin-containing compound metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	15327587, 19219744
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IBA
GO:0008210	Process	Estrogen metabolic process	IDA	11555828, 12865317
GO:0008395	Function	Steroid hydroxylase activity	IBA
GO:0008395	Function	Steroid hydroxylase activity	IEA
GO:0009055	Function	Electron transfer activity	TAS	2813353
GO:0009403	Process	Toxin biosynthetic process	IDA	11511187
GO:0009404	Process	Toxin metabolic process	IBA
GO:0009404	Process	Toxin metabolic process	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009820	Process	Alkaloid metabolic process	IDA	11511187
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0016098	Process	Monoterpenoid metabolic process	IDA	16401082
GO:0016491	Function	Oxidoreductase activity	IDA	16401082, 19219744
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IMP	2813353
GO:0016829	Function	Lyase activity	IEA
GO:0018894	Process	Dibenzo-p-dioxin metabolic process	IEA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019373	Process	Epoxygenase P450 pathway	TAS
GO:0019899	Function	Enzyme binding	IPI	15680923
GO:0020037	Function	Heme binding	IDA	17311915
GO:0020037	Function	Heme binding	IEA
GO:0030324	Process	Lung development	IEA
GO:0032259	Process	Methylation	TAS
GO:0032451	Function	Demethylase activity	IDA	2813353
GO:0032787	Process	Monocarboxylic acid metabolic process	IDA	19651758
GO:0034875	Function	Caffeine oxidase activity	IDA	18619574
GO:0042178	Process	Xenobiotic catabolic process	IBA
GO:0042178	Process	Xenobiotic catabolic process	IDA	18619574
GO:0042178	Process	Xenobiotic catabolic process	IMP	18356043
GO:0042445	Process	Hormone metabolic process	IEA
GO:0042572	Process	Retinol metabolic process	IDA	10681376
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	2813353
GO:0045333	Process	Cellular respiration	IEA
GO:0046222	Process	Aflatoxin metabolic process	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	IEA
GO:0070989	Process	Oxidative demethylation	IDA	18619574
GO:0071276	Process	Cellular response to cadmium ion	IEA
GO:0097267	Process	Omega-hydroxylase P450 pathway	TAS
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IDA	11555828
GO:0101021	Function	Estrogen 2-hydroxylase activity	IDA	11555828, 12865317
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA
GO:0106256	Function	Hydroperoxy icosatetraenoate dehydratase activity	IEA
GO:0120254	Process	Olefinic compound metabolic process	IEA

MIM	HGNC	e!Ensembl
124060	2596	ENSG00000140505

P05177

Protein name

Cytochrome P450 1A2 (EC 1.14.14.1) (CYPIA2) (Cholesterol 25-hydroxylase) (Cytochrome P(3)450) (Cytochrome P450 4) (Cytochrome P450-P3) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152)

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins (PubMed:10681376, PubMed:11555828, PubMed:12865317, PubMed:19965576, PubMed:9435160). Mechanistical

PDB

2HI4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	42 → 505	Cytochrome P450	Domain

Tissue specificity

TISSUE SPECIFICITY: Liver.

Sequence

MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN

Sequence length

516

Interactions

View interactions

	KEGG		Reactome
	Steroid hormone biosynthesis Caffeine metabolism Tryptophan metabolism Linoleic acid metabolism Retinol metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Metabolic pathways Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species		Methylation Aromatic amines can be N-hydroxylated or N-dealkylated by CYP1A2 Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) Aflatoxin activation and detoxification Biosynthesis of protectins Biosynthesis of maresin-like SPMs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (43)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METHEMOGLOBINEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECT, FOLATE-SENSITIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS X-LINKED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PORPHYRIA CUTANEA TARDA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA AND RELATED DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (194)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acrania	Acrania	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11285205, 17509724, 19332078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11285205, 19332078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15987714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11875368, 18751408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16157215, 18751408, 22628494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28095090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36430879	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17852022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome, Autosomal Dominant	Antley-Bixler Syndrome	BEFREE	18455494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30248915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30248915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27029552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28794002, 8375127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12732846, 17672811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28794002, 8375127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29692210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	22823064		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	11204250, 17891543, 22344197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	10933049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10022251, 18690546, 20559687, 21056942, 21480221, 22961351, 25472037, 26514519, 27173252, 8877060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18200441, 18703023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	31556777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15217502, 15941966, 16103451, 16538170, 17295924, 17507615, 18398030, 18813311, 19229255, 19415745, 20054636, 21329464, 21977969, 23128882, 23530639 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15217502, 15241822, 17295924, 18059023, 18398030, 18813311, 25228414, 25689428, 25921178, 27029552, 28418906, 31477036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17695473, 18751408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18751408, 437913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22447115, 26516155, 30971588, 33654112, 38565301, 7524447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25024626	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10022251, 20559687, 21056942, 21480221, 22961351, 25472037, 26514519, 27173252, 8877060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11285205, 15890241, 17477782, 17509724, 1820735, 18409147, 1844821, 19276377, 19332078, 22749033, 23138776, 23462460, 23803095, 24293373, 25081684 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22072123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11303589, 12925300, 23628800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29577422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27363424, 30838377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33046100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15901993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	27565560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	BEFREE	28990182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	19643819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18389617		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20080081, 20797314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	20797314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic schizophrenia	Schizophrenia	BEFREE	16969362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	25024626, 7741759		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	27878760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29197979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	7694097, 9783729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11059519, 11751443, 12351160, 16006997, 16157215, 16800822, 17615053, 17627011, 18159984, 19273964, 19452301, 21081473, 21490239, 21618522, 23951174, 24318358, 24514875, 25115775, 7694097 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	21081473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16800822, 17615053, 17695473, 18751408, 21081473, 23951174	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17615053, 18159984		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	21081473		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	15901993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33046100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15466009, 29449662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniorachischisis	Craniorachischisis	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	7955816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29534510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29534510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29439084, 32814585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	22244987		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diastematomyelia	Diastematomyelia	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18318428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21958689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26762380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	27977510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	27977510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27712037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	30979496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	27565560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30713339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	29976226	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Defects Congenital	Congenital heart defect	Pubtator	29449662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	24762860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	19906068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31706005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	30869529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	34117631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	17503978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30838377	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	19451835, 22492992, 25595320, 26751575, 30838377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	31324842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension Orthostatic	Orthostatic hypotension	Pubtator	24555493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38287425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29197979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iniencephaly	Anencephaly	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	36701157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15996939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23648678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	18160779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11470995, 12135113, 16495781, 1657755, 1844873, 19643819, 22006857, 2206399, 25024626, 26516155, 26643992, 28040498, 30234976, 30869529, 9783729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12566081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25024626, 7741759		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	27565560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	25024626	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	22291093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12135113, 1844873, 2206399, 30869529, 9783729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17477782		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	17477782, 19276377	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	22072123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	29437786		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	21121774, 30875344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15217502, 15941966, 16103451, 16538170, 17295924, 17507615, 18398030, 18813311, 19229255, 19415745, 20054636, 21329464, 21977969, 23128882, 23530639 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	18318428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11285205, 15890241, 17477782, 17509724, 1820735, 18409147, 1844821, 19276377, 19332078, 22749033, 23138776, 23462460, 23803095, 24293373, 25081684 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	22072123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23648678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11303589, 12925300, 23628800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15987714, 18499698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11275366, 25355624, 29165164, 29973138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20047124, 23686565, 24443269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10022251, 20559687, 21056942, 21480221, 22961351, 25472037, 26514519, 27173252, 8877060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10551315, 12569554, 15901993, 16402077, 22749033, 23157985, 23462460, 23628800, 25472037, 26865042, 27428168, 29197745, 31480463, 31608602, 31784319, 437913, 540021, 7789356 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	7694097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17507615, 18398030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	22048975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Methemoglobinemia	Methemoglobinemia	CTD_human_DG	12030840		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	20213484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	22615781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15466009, 16522833, 30838377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15466009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	30838377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10469630, 15845371, 16096788, 21977969, 23412805, 23648678, 24114584, 28404946, 30869529, 8603349		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29197979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	20641098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural Tube Defect	CTD_human_DG	20641098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	20641098	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurenteric Cyst	Neurenteric Cyst	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	27565560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28444958		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	27565560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	26002927, 28560524		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11303589, 12925300, 23628800		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18497059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15987714, 18499698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15987714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15987714, 18499698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	LHGDN	15363478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18075470, 20304699, 21281405, 23565891, 28135712, 28317317, 29318639, 8627546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	20304699, 21281405, 29318639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	22615781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	23686565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	8375127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	8375127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	22823064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	9141515, 9453493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	18268115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	11153915, 12566081, 14714565, 20163457, 20957336, 21929532		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	CTD_human_DG	11153915		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	LHGDN	12566081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porphyria Cutanea Tarda	Porphyria cutanea tarda	Pubtator	20163457, 20957336	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	22674224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11275366, 25355624, 29165164, 29973138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29165164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20797314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21618522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28718679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30503378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	7761462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18496682, 19579025, 25664505, 26331989, 28718679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18496682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10850389, 10889552, 11179771, 11496364, 11817502, 15206669, 15505641, 15564895, 16490169, 16775389, 16969362, 17611010, 17688403, 20143052, 22901441, 23601795, 29921201 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21142916		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	21142916		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	PSYGENET_DG	21142916		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	16820944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	29607154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	25059483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Myelodysplasia	Spinal Cord Myelodysplasia	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenic Diseases	Splenic Diseases	CTD_human_DG	20961953		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sporadic porphyria cutanea tarda	Porphyria Cutanea Tarda	BEFREE	20163457, 21929532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17509724, 19332078, 22072123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	CTD_human_DG	22072123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29278931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19442564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	17509724, 22072123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19442564, 27894333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20047124, 23686565, 24443269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	33046100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	LHGDN	14976127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tethered Cord Syndrome	Primary Tethered cord syndrome	CTD_human_DG	20641098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	31608602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	31608602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	23601795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	18703023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	18398030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16636061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	21480221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21480221, 26514519, 27173252, 7786445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CYP1A2 (cytochrome P450 family 1 subfamily A member 2)