SLC2A12 (solute carrier family 2 member 12)

Gene

• Entrez ID: 154091
• Gene name: Solute carrier family 2 member 12
• Gene symbol: SLC2A12
• Synonyms (NCBI Gene): GLUT12, GLUT8
• Chromosome: 6
• Chromosome location: 6q23.2
• Summary: SLC2A12 belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion (Rogers et al., 2002). This family of transporters show conservation of 12 transmembrane helices as well as functionally significant amino acid re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017063	hsa-miR-335-5p	Microarray	18185580
MIRT518659	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518658	hsa-miR-501-3p	HITS-CLIP	21572407
MIRT518657	hsa-miR-502-3p	HITS-CLIP	21572407
MIRT518656	hsa-miR-767-5p	HITS-CLIP	21572407
MIRT518655	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT518653	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518652	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518659	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT518658	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT518657	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT518656	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT518655	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT518653	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT518652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT518659	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518658	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT518657	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT518656	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT518655	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT518654	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT518653	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518652	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518651	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT518659	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518658	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT518657	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT518656	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT518655	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT518654	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT518653	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518652	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT518651	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT518652	hsa-miR-1277-5p	HITS-CLIP	27418678
MIRT518652	hsa-miR-1277-5p	HITS-CLIP	27418678
MIRT518653	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT518653	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT518653	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT518655	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT518655	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT518655	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT518659	hsa-miR-5011-5p	HITS-CLIP	27418678
MIRT518659	hsa-miR-5011-5p	HITS-CLIP	27418678
MIRT518659	hsa-miR-5011-5p	HITS-CLIP	27418678
MIRT518651	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT518651	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT518651	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT518654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT518654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT518654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT518659	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518658	hsa-miR-501-3p	HITS-CLIP	21572407
MIRT518657	hsa-miR-502-3p	HITS-CLIP	21572407
MIRT518656	hsa-miR-767-5p	HITS-CLIP	21572407
MIRT518655	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT518653	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518652	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518659	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT518658	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT518657	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT518656	hsa-miR-767-5p	PAR-CLIP	20371350
MIRT518655	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT518653	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT518652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT518659	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518658	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT518657	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT518656	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT518655	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT518654	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT518653	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518652	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518651	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT518659	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518658	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT518657	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT518656	hsa-miR-767-5p	PAR-CLIP	23446348
MIRT518655	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT518654	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT518653	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518652	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT518651	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT1358556	hsa-miR-132	CLIP-seq
MIRT1358557	hsa-miR-147	CLIP-seq
MIRT1358558	hsa-miR-212	CLIP-seq
MIRT1358559	hsa-miR-2964a-5p	CLIP-seq
MIRT1358560	hsa-miR-3123	CLIP-seq
MIRT1358561	hsa-miR-3148	CLIP-seq
MIRT1358562	hsa-miR-3185	CLIP-seq
MIRT1358563	hsa-miR-3190	CLIP-seq
MIRT1358564	hsa-miR-3194-3p	CLIP-seq
MIRT1358565	hsa-miR-3611	CLIP-seq
MIRT1358566	hsa-miR-3664-3p	CLIP-seq
MIRT1358567	hsa-miR-376a	CLIP-seq
MIRT1358568	hsa-miR-376b	CLIP-seq
MIRT1358569	hsa-miR-3925-5p	CLIP-seq
MIRT1358570	hsa-miR-3927	CLIP-seq
MIRT1358571	hsa-miR-3976	CLIP-seq
MIRT1358572	hsa-miR-4311	CLIP-seq
MIRT1358573	hsa-miR-4433	CLIP-seq
MIRT1358574	hsa-miR-4452	CLIP-seq
MIRT1358575	hsa-miR-4650-3p	CLIP-seq
MIRT1358576	hsa-miR-4662a-5p	CLIP-seq
MIRT1358577	hsa-miR-4677-3p	CLIP-seq
MIRT1358578	hsa-miR-4679	CLIP-seq
MIRT1358579	hsa-miR-4720-3p	CLIP-seq
MIRT1358580	hsa-miR-4752	CLIP-seq
MIRT1358581	hsa-miR-4760-3p	CLIP-seq
MIRT1358582	hsa-miR-4789-3p	CLIP-seq
MIRT1358583	hsa-miR-4795-3p	CLIP-seq
MIRT1358584	hsa-miR-488	CLIP-seq
MIRT1358585	hsa-miR-510	CLIP-seq
MIRT1358586	hsa-miR-524-3p	CLIP-seq
MIRT1358587	hsa-miR-525-3p	CLIP-seq
MIRT1358588	hsa-miR-599	CLIP-seq
MIRT1358589	hsa-miR-656	CLIP-seq
MIRT1358590	hsa-miR-658	CLIP-seq
MIRT1358564	hsa-miR-3194-3p	CLIP-seq
MIRT2106213	hsa-miR-3692	CLIP-seq
MIRT1358580	hsa-miR-4752	CLIP-seq
MIRT1358564	hsa-miR-3194-3p	CLIP-seq
MIRT2330517	hsa-miR-3200-5p	CLIP-seq
MIRT1358565	hsa-miR-3611	CLIP-seq
MIRT2330518	hsa-miR-4711-3p	CLIP-seq
MIRT2394706	hsa-miR-1262	CLIP-seq
MIRT1358557	hsa-miR-147	CLIP-seq
MIRT2394707	hsa-miR-3117-3p	CLIP-seq
MIRT2394708	hsa-miR-3911	CLIP-seq
MIRT1358572	hsa-miR-4311	CLIP-seq
MIRT2394709	hsa-miR-4701-3p	CLIP-seq
MIRT2394710	hsa-miR-570	CLIP-seq
MIRT1358588	hsa-miR-599	CLIP-seq
MIRT2394711	hsa-miR-644	CLIP-seq
MIRT1358564	hsa-miR-3194-3p	CLIP-seq
MIRT2330517	hsa-miR-3200-5p	CLIP-seq
MIRT2459656	hsa-miR-3613-3p	CLIP-seq
MIRT2459657	hsa-miR-4539	CLIP-seq
MIRT2330518	hsa-miR-4711-3p	CLIP-seq
MIRT2459658	hsa-miR-935	CLIP-seq
MIRT2624545	hsa-miR-1305	CLIP-seq
MIRT2624546	hsa-miR-224	CLIP-seq
MIRT2624547	hsa-miR-3159	CLIP-seq
MIRT2624548	hsa-miR-4320	CLIP-seq
MIRT2624549	hsa-miR-4659a-3p	CLIP-seq
MIRT2624550	hsa-miR-4659b-3p	CLIP-seq
MIRT2624551	hsa-miR-4753-3p	CLIP-seq
MIRT2624552	hsa-miR-651	CLIP-seq
MIRT2624553	hsa-miR-760	CLIP-seq
MIRT2624547	hsa-miR-3159	CLIP-seq
MIRT2624548	hsa-miR-4320	CLIP-seq
MIRT2624549	hsa-miR-4659a-3p	CLIP-seq
MIRT2624550	hsa-miR-4659b-3p	CLIP-seq
MIRT2624551	hsa-miR-4753-3p	CLIP-seq
MIRT2624552	hsa-miR-651	CLIP-seq
MIRT2624553	hsa-miR-760	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008645	Process	Hexose transmembrane transport	IEA
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	TAS
GO:0055085	Process	Transmembrane transport	IEA
GO:0072359	Process	Circulatory system development	IBA
GO:1904659	Process	D-glucose transmembrane transport	IBA
GO:1904659	Process	D-glucose transmembrane transport	IEA

Other IDs

• MIM: 610372
• HGNC: 18067
• e!Ensembl: ENSG00000146411

Protein

• UniProt ID: Q8TD20
• Protein name: Solute carrier family 2, facilitated glucose transporter member 12 (Glucose transporter type 12) (GLUT-12)
• Protein function: Insulin-independent facilitative glucose transporter.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	43 → 375	Sugar (and other) transporter	Family
  PF00083	Sugar_tr	441 → 564	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in skeletal muscle, heart and prostate, with lower levels in brain, placenta and kidney. {ECO:0000269|PubMed:11832379}.
• Sequence:

  MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGI
  ISGALLQIKTLLALSCHEQEMVVSSLVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLG
  SLVLILSLSYTVLIVGRIAIGVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGIL
  SAYISNYAFANVFHGWKYMFGLVIPLGVLQAIAMYFLPPSPRFLVMKGQEGAASKVLGRL
  RALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTRIMIGLTLVFFVQITGQPNILFY
  ASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFLCIGSSVMAASLVT
  MGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLM
  PLRNDVDKRGETTSASLLNAGLSHTEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLG
  PMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLA
  SLLFVVMFIPETKGCSLEQISMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLE
  CNKLCGRGQSRQLSPET

• Sequence length: 617

Pathways

Reactome:

Cellular hexose transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyloidosis	Amyloidosis	BEFREE	31473905		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29187448, 31002200		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	23041416		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34555239	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23041416		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28034463		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31676315		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16091581		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16091581		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28471544		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29187448, 31002200		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15389572, 29431615, 31806771		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22452979		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19554504		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	25776730	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31473905		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24519932		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31002200		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15389572, 29431615, 31806771		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15389572		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29431615	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37542344	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32799763	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36594084	Stimulate	★☆☆☆☆ Found in Text Mining only