Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	153572
Gene name	Iroquois homeobox 2
Gene symbol	IRX2
Synonyms (NCBI Gene)	IRXA2
Chromosome	5
Chromosome location	5p15.33
Summary	IRX2 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM, Apr 2004]

196

Show/Hide all (196)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017070	hsa-miR-335-5p	Microarray	18185580
MIRT635297	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT635296	hsa-miR-4504	HITS-CLIP	23824327
MIRT635295	hsa-miR-542-3p	HITS-CLIP	23824327
MIRT635294	hsa-miR-6808-3p	HITS-CLIP	23824327
MIRT635293	hsa-miR-607	HITS-CLIP	23824327
MIRT635292	hsa-miR-758-3p	HITS-CLIP	23824327
MIRT635291	hsa-miR-1305	HITS-CLIP	23824327
MIRT635290	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT635291	hsa-miR-1305	HITS-CLIP	27418678
MIRT635291	hsa-miR-1305	HITS-CLIP	27418678
MIRT635291	hsa-miR-1305	HITS-CLIP	27418678
MIRT635297	hsa-miR-330-3p	HITS-CLIP	27418678
MIRT635297	hsa-miR-330-3p	HITS-CLIP	27418678
MIRT635297	hsa-miR-330-3p	HITS-CLIP	27418678
MIRT635290	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT635290	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT635290	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT635293	hsa-miR-607	HITS-CLIP	27418678
MIRT635293	hsa-miR-607	HITS-CLIP	27418678
MIRT635293	hsa-miR-607	HITS-CLIP	27418678
MIRT635297	hsa-miR-330-3p	HITS-CLIP	23824327
MIRT635296	hsa-miR-4504	HITS-CLIP	23824327
MIRT635295	hsa-miR-542-3p	HITS-CLIP	23824327
MIRT635294	hsa-miR-6808-3p	HITS-CLIP	23824327
MIRT635293	hsa-miR-607	HITS-CLIP	23824327
MIRT635292	hsa-miR-758-3p	HITS-CLIP	23824327
MIRT635291	hsa-miR-1305	HITS-CLIP	23824327
MIRT635290	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT1072259	hsa-miR-101	CLIP-seq
MIRT1072260	hsa-miR-1200	CLIP-seq
MIRT1072261	hsa-miR-1228	CLIP-seq
MIRT1072262	hsa-miR-1245	CLIP-seq
MIRT1072263	hsa-miR-1290	CLIP-seq
MIRT1072264	hsa-miR-144	CLIP-seq
MIRT1072265	hsa-miR-153	CLIP-seq
MIRT1072266	hsa-miR-224	CLIP-seq
MIRT1072267	hsa-miR-28-3p	CLIP-seq
MIRT1072268	hsa-miR-3065-5p	CLIP-seq
MIRT1072269	hsa-miR-3074-3p	CLIP-seq
MIRT1072270	hsa-miR-3163	CLIP-seq
MIRT1072271	hsa-miR-3167	CLIP-seq
MIRT1072272	hsa-miR-3177-5p	CLIP-seq
MIRT1072273	hsa-miR-340	CLIP-seq
MIRT1072274	hsa-miR-3616-5p	CLIP-seq
MIRT1072275	hsa-miR-3647-5p	CLIP-seq
MIRT1072276	hsa-miR-3658	CLIP-seq
MIRT1072277	hsa-miR-3674	CLIP-seq
MIRT1072278	hsa-miR-3688-5p	CLIP-seq
MIRT1072279	hsa-miR-377	CLIP-seq
MIRT1072280	hsa-miR-3908	CLIP-seq
MIRT1072281	hsa-miR-4251	CLIP-seq
MIRT1072282	hsa-miR-4318	CLIP-seq
MIRT1072283	hsa-miR-4324	CLIP-seq
MIRT1072284	hsa-miR-4445	CLIP-seq
MIRT1072285	hsa-miR-448	CLIP-seq
MIRT1072286	hsa-miR-4514	CLIP-seq
MIRT1072287	hsa-miR-4527	CLIP-seq
MIRT1072288	hsa-miR-4528	CLIP-seq
MIRT1072289	hsa-miR-4645-5p	CLIP-seq
MIRT1072290	hsa-miR-4673	CLIP-seq
MIRT1072291	hsa-miR-4692	CLIP-seq
MIRT1072292	hsa-miR-4693-5p	CLIP-seq
MIRT1072293	hsa-miR-4699-3p	CLIP-seq
MIRT1072294	hsa-miR-4760-5p	CLIP-seq
MIRT1072295	hsa-miR-4782-5p	CLIP-seq
MIRT1072296	hsa-miR-4789-3p	CLIP-seq
MIRT1072297	hsa-miR-4795-5p	CLIP-seq
MIRT1072298	hsa-miR-508-3p	CLIP-seq
MIRT1072299	hsa-miR-520d-5p	CLIP-seq
MIRT1072300	hsa-miR-524-5p	CLIP-seq
MIRT1072301	hsa-miR-539	CLIP-seq
MIRT1072302	hsa-miR-542-5p	CLIP-seq
MIRT1072303	hsa-miR-544b	CLIP-seq
MIRT1072304	hsa-miR-548aa	CLIP-seq
MIRT1072305	hsa-miR-548ac	CLIP-seq
MIRT1072306	hsa-miR-548ae	CLIP-seq
MIRT1072307	hsa-miR-548aj	CLIP-seq
MIRT1072308	hsa-miR-548am	CLIP-seq
MIRT1072309	hsa-miR-548c-3p	CLIP-seq
MIRT1072310	hsa-miR-548d-3p	CLIP-seq
MIRT1072311	hsa-miR-548x	CLIP-seq
MIRT1072312	hsa-miR-548z	CLIP-seq
MIRT1072313	hsa-miR-561	CLIP-seq
MIRT1072314	hsa-miR-568	CLIP-seq
MIRT1072315	hsa-miR-573	CLIP-seq
MIRT1072316	hsa-miR-576-3p	CLIP-seq
MIRT1072317	hsa-miR-582-5p	CLIP-seq
MIRT1072318	hsa-miR-605	CLIP-seq
MIRT1072319	hsa-miR-634	CLIP-seq
MIRT1072320	hsa-miR-876-5p	CLIP-seq
MIRT1072321	hsa-miR-888	CLIP-seq
MIRT1072322	hsa-miR-892a	CLIP-seq
MIRT1072265	hsa-miR-153	CLIP-seq
MIRT1072266	hsa-miR-224	CLIP-seq
MIRT2017850	hsa-miR-23a	CLIP-seq
MIRT2017851	hsa-miR-23b	CLIP-seq
MIRT2017852	hsa-miR-23c	CLIP-seq
MIRT1072267	hsa-miR-28-3p	CLIP-seq
MIRT1072268	hsa-miR-3065-5p	CLIP-seq
MIRT2017853	hsa-miR-3607-3p	CLIP-seq
MIRT2017854	hsa-miR-3692	CLIP-seq
MIRT1072279	hsa-miR-377	CLIP-seq
MIRT2017855	hsa-miR-4436b-5p	CLIP-seq
MIRT1072284	hsa-miR-4445	CLIP-seq
MIRT1072285	hsa-miR-448	CLIP-seq
MIRT1072293	hsa-miR-4699-3p	CLIP-seq
MIRT1072294	hsa-miR-4760-5p	CLIP-seq
MIRT1072296	hsa-miR-4789-3p	CLIP-seq
MIRT2017856	hsa-miR-513a-3p	CLIP-seq
MIRT1072302	hsa-miR-542-5p	CLIP-seq
MIRT1072313	hsa-miR-561	CLIP-seq
MIRT1072321	hsa-miR-888	CLIP-seq
MIRT1072259	hsa-miR-101	CLIP-seq
MIRT1072260	hsa-miR-1200	CLIP-seq
MIRT1072261	hsa-miR-1228	CLIP-seq
MIRT1072262	hsa-miR-1245	CLIP-seq
MIRT1072263	hsa-miR-1290	CLIP-seq
MIRT1072264	hsa-miR-144	CLIP-seq
MIRT1072266	hsa-miR-224	CLIP-seq
MIRT2017850	hsa-miR-23a	CLIP-seq
MIRT2017851	hsa-miR-23b	CLIP-seq
MIRT2017852	hsa-miR-23c	CLIP-seq
MIRT1072267	hsa-miR-28-3p	CLIP-seq
MIRT1072268	hsa-miR-3065-5p	CLIP-seq
MIRT1072269	hsa-miR-3074-3p	CLIP-seq
MIRT1072271	hsa-miR-3167	CLIP-seq
MIRT1072272	hsa-miR-3177-5p	CLIP-seq
MIRT2249657	hsa-miR-3613-5p	CLIP-seq
MIRT1072274	hsa-miR-3616-5p	CLIP-seq
MIRT1072275	hsa-miR-3647-5p	CLIP-seq
MIRT1072278	hsa-miR-3688-5p	CLIP-seq
MIRT2017854	hsa-miR-3692	CLIP-seq
MIRT1072279	hsa-miR-377	CLIP-seq
MIRT1072281	hsa-miR-4251	CLIP-seq
MIRT1072282	hsa-miR-4318	CLIP-seq
MIRT1072283	hsa-miR-4324	CLIP-seq
MIRT2017855	hsa-miR-4436b-5p	CLIP-seq
MIRT1072284	hsa-miR-4445	CLIP-seq
MIRT1072287	hsa-miR-4527	CLIP-seq
MIRT1072288	hsa-miR-4528	CLIP-seq
MIRT1072292	hsa-miR-4693-5p	CLIP-seq
MIRT1072293	hsa-miR-4699-3p	CLIP-seq
MIRT1072294	hsa-miR-4760-5p	CLIP-seq
MIRT1072295	hsa-miR-4782-5p	CLIP-seq
MIRT1072296	hsa-miR-4789-3p	CLIP-seq
MIRT1072297	hsa-miR-4795-5p	CLIP-seq
MIRT1072299	hsa-miR-520d-5p	CLIP-seq
MIRT1072300	hsa-miR-524-5p	CLIP-seq
MIRT1072301	hsa-miR-539	CLIP-seq
MIRT1072302	hsa-miR-542-5p	CLIP-seq
MIRT1072303	hsa-miR-544b	CLIP-seq
MIRT1072313	hsa-miR-561	CLIP-seq
MIRT1072315	hsa-miR-573	CLIP-seq
MIRT1072316	hsa-miR-576-3p	CLIP-seq
MIRT1072317	hsa-miR-582-5p	CLIP-seq
MIRT1072318	hsa-miR-605	CLIP-seq
MIRT1072320	hsa-miR-876-5p	CLIP-seq
MIRT1072321	hsa-miR-888	CLIP-seq
MIRT1072322	hsa-miR-892a	CLIP-seq
MIRT2553125	hsa-miR-1237	CLIP-seq
MIRT2553126	hsa-miR-1248	CLIP-seq
MIRT2553127	hsa-miR-147	CLIP-seq
MIRT2553128	hsa-miR-3691-5p	CLIP-seq
MIRT2553129	hsa-miR-3911	CLIP-seq
MIRT2553130	hsa-miR-4645-3p	CLIP-seq
MIRT2553131	hsa-miR-4752	CLIP-seq
MIRT2553132	hsa-miR-4753-3p	CLIP-seq
MIRT2553133	hsa-miR-512-3p	CLIP-seq
MIRT1072316	hsa-miR-576-3p	CLIP-seq
MIRT1072317	hsa-miR-582-5p	CLIP-seq
MIRT2553134	hsa-miR-644	CLIP-seq
MIRT2553135	hsa-miR-942	CLIP-seq
MIRT2553125	hsa-miR-1237	CLIP-seq
MIRT2553126	hsa-miR-1248	CLIP-seq
MIRT1072263	hsa-miR-1290	CLIP-seq
MIRT2553127	hsa-miR-147	CLIP-seq
MIRT1072271	hsa-miR-3167	CLIP-seq
MIRT2017853	hsa-miR-3607-3p	CLIP-seq
MIRT2249657	hsa-miR-3613-5p	CLIP-seq
MIRT2682916	hsa-miR-3686	CLIP-seq
MIRT2553128	hsa-miR-3691-5p	CLIP-seq
MIRT2553129	hsa-miR-3911	CLIP-seq
MIRT1072287	hsa-miR-4527	CLIP-seq
MIRT2553130	hsa-miR-4645-3p	CLIP-seq
MIRT2553131	hsa-miR-4752	CLIP-seq
MIRT2553132	hsa-miR-4753-3p	CLIP-seq
MIRT1072295	hsa-miR-4782-5p	CLIP-seq
MIRT2553133	hsa-miR-512-3p	CLIP-seq
MIRT2017856	hsa-miR-513a-3p	CLIP-seq
MIRT2682917	hsa-miR-556-5p	CLIP-seq
MIRT1072316	hsa-miR-576-3p	CLIP-seq
MIRT1072317	hsa-miR-582-5p	CLIP-seq
MIRT2553134	hsa-miR-644	CLIP-seq
MIRT1072320	hsa-miR-876-5p	CLIP-seq
MIRT2553135	hsa-miR-942	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	26560478
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	26560478
GO:0001656	Process	Metanephros development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0030182	Process	Neuron differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0048468	Process	Cell development	IBA
GO:0072086	Process	Specification of loop of Henle identity	IEA
GO:0072272	Process	Proximal/distal pattern formation involved in metanephric nephron development	IEA

MIM	HGNC	e!Ensembl
606198	14359	ENSG00000170561

Q9BZI1

Protein name

Iroquois-class homeodomain protein IRX-2 (Homeodomain protein IRXA2) (Iroquois homeobox protein 2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05920	Homeobox_KN	132 → 171	Homeobox KN domain	Family

Sequence

MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAAT
GFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKN
ATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW
APRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEK
LPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPP
EAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAP
ASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEA
LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL

Sequence length

471

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL SARCOMA OF KIDNEY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	28570300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26497896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26560478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19706770, 26560478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	30108103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22143938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	25481751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell sarcoma of kidney	Sarcoma Of Kidney	ORPHANET_DG	25481751, 26493387		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell sarcoma of kidney	Sarcoma Of Kidney	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelioma	Epithelioma	BEFREE	29721379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31599112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31599112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	21238641		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	26560478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24806332, 29721379, 31831558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16752383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26560478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34717154	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10370142, 24806332, 29721379, 29988729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24806332, 26062523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30108103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	16752383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	16752383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22270713, 34717154	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

IRX2 (iroquois homeobox 2)