Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	153562
Gene name	MARVEL domain containing 2
Gene symbol	MARVELD2
Synonyms (NCBI Gene)	DFNB49MARVD2MRVLDC2Tric
Chromosome	5
Chromosome location	5q13.2
Summary	The protein encoded by this gene is a membrane protein found at the tight junctions between epithelial cells. The encoded protein helps establish epithelial barriers such as those in the organ of Corti, where these barriers are required for normal hearing

Show/Hide all (15)

SNP ID	Visualize variation	Clinical significance	Consequence
rs61736168	C>T	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs72773422	T>A	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs118203957	C>G,T	Pathogenic-likely-pathogenic, pathogenic	Stop gained, coding sequence variant, missense variant
rs143592561	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, coding sequence variant
rs144717803	T>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant
rs150434290	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs200781822	G>A	Pathogenic	Splice acceptor variant
rs748539820	AC>-	Pathogenic	Coding sequence variant, frameshift variant
rs762352115	G>A	Pathogenic, pathogenic-likely-pathogenic	Splice donor variant
rs770042200	TTTGGAATTAA>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs993107184	G>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1336624126	C>G	Pathogenic	Coding sequence variant, intron variant, stop gained
rs1554046316	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1561291313	G>A	Pathogenic	Coding sequence variant, stop gained
rs1561299289	->A	Pathogenic	Coding sequence variant, frameshift variant

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT314164	hsa-miR-548an	PAR-CLIP	21572407
MIRT551307	hsa-miR-5692a	PAR-CLIP	21572407
MIRT314162	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT314163	hsa-miR-3714	PAR-CLIP	21572407
MIRT551306	hsa-miR-1179	PAR-CLIP	21572407
MIRT314161	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT314156	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT314158	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT314157	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT408433	hsa-miR-621	PAR-CLIP	21572407
MIRT314152	hsa-miR-4293	PAR-CLIP	23446348
MIRT314150	hsa-miR-1244	PAR-CLIP	23446348
MIRT314154	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT314155	hsa-miR-7977	PAR-CLIP	23446348
MIRT458504	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT458503	hsa-miR-5186	PAR-CLIP	23592263
MIRT458502	hsa-miR-4537	PAR-CLIP	23592263
MIRT458501	hsa-miR-6134	PAR-CLIP	23592263
MIRT458500	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT458499	hsa-miR-6086	PAR-CLIP	23592263
MIRT458498	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT458497	hsa-miR-4252	PAR-CLIP	23592263
MIRT458496	hsa-miR-3689d	PAR-CLIP	23592263
MIRT458495	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT458494	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT458493	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT458492	hsa-miR-1227-3p	PAR-CLIP	23592263
MIRT458491	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT458490	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT458489	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT458488	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT314164	hsa-miR-548an	PAR-CLIP	21572407
MIRT551307	hsa-miR-5692a	PAR-CLIP	21572407
MIRT314162	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT314163	hsa-miR-3714	PAR-CLIP	21572407
MIRT551306	hsa-miR-1179	PAR-CLIP	21572407
MIRT314161	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT314156	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT314158	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT314157	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT408433	hsa-miR-621	PAR-CLIP	21572407
MIRT314152	hsa-miR-4293	PAR-CLIP	23446348
MIRT314150	hsa-miR-1244	PAR-CLIP	23446348
MIRT314154	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT314155	hsa-miR-7977	PAR-CLIP	23446348
MIRT458504	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT458503	hsa-miR-5186	PAR-CLIP	23592263
MIRT458502	hsa-miR-4537	PAR-CLIP	23592263
MIRT458501	hsa-miR-6134	PAR-CLIP	23592263
MIRT458500	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT458499	hsa-miR-6086	PAR-CLIP	23592263
MIRT458498	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT458497	hsa-miR-4252	PAR-CLIP	23592263
MIRT458496	hsa-miR-3689d	PAR-CLIP	23592263
MIRT458495	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT458494	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT458493	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT458492	hsa-miR-1227-3p	PAR-CLIP	23592263
MIRT458491	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT458490	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT458489	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT458488	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT1132890	hsa-miR-2964a-3p	CLIP-seq
MIRT1132891	hsa-miR-302f	CLIP-seq
MIRT1132892	hsa-miR-3150a-5p	CLIP-seq
MIRT1132893	hsa-miR-3150b-5p	CLIP-seq
MIRT1132894	hsa-miR-3613-3p	CLIP-seq
MIRT1132895	hsa-miR-3688-5p	CLIP-seq
MIRT1132896	hsa-miR-371-5p	CLIP-seq
MIRT1132897	hsa-miR-371b-5p	CLIP-seq
MIRT1132898	hsa-miR-4321	CLIP-seq
MIRT1132899	hsa-miR-4455	CLIP-seq
MIRT1132900	hsa-miR-4684-5p	CLIP-seq
MIRT1132901	hsa-miR-4768-3p	CLIP-seq
MIRT1132902	hsa-miR-4781-5p	CLIP-seq
MIRT1132903	hsa-miR-644	CLIP-seq
MIRT1132904	hsa-miR-885-3p	CLIP-seq
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT2267912	hsa-miR-1227	CLIP-seq
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT2267913	hsa-miR-194	CLIP-seq
MIRT2267914	hsa-miR-217	CLIP-seq
MIRT1132890	hsa-miR-2964a-3p	CLIP-seq
MIRT1132891	hsa-miR-302f	CLIP-seq
MIRT1132892	hsa-miR-3150a-5p	CLIP-seq
MIRT1132893	hsa-miR-3150b-5p	CLIP-seq
MIRT1132900	hsa-miR-4684-5p	CLIP-seq
MIRT1132901	hsa-miR-4768-3p	CLIP-seq
MIRT2267915	hsa-miR-548c-3p	CLIP-seq
MIRT2267916	hsa-miR-555	CLIP-seq
MIRT2267917	hsa-miR-661	CLIP-seq
MIRT2267912	hsa-miR-1227	CLIP-seq
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT2267913	hsa-miR-194	CLIP-seq
MIRT2267914	hsa-miR-217	CLIP-seq
MIRT1132890	hsa-miR-2964a-3p	CLIP-seq
MIRT1132891	hsa-miR-302f	CLIP-seq
MIRT1132901	hsa-miR-4768-3p	CLIP-seq
MIRT2267916	hsa-miR-555	CLIP-seq
MIRT2267917	hsa-miR-661	CLIP-seq
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT1132890	hsa-miR-2964a-3p	CLIP-seq
MIRT1132891	hsa-miR-302f	CLIP-seq
MIRT1132892	hsa-miR-3150a-5p	CLIP-seq
MIRT1132893	hsa-miR-3150b-5p	CLIP-seq
MIRT1132898	hsa-miR-4321	CLIP-seq
MIRT1132900	hsa-miR-4684-5p	CLIP-seq
MIRT1132901	hsa-miR-4768-3p	CLIP-seq
MIRT1132902	hsa-miR-4781-5p	CLIP-seq
MIRT2267915	hsa-miR-548c-3p	CLIP-seq
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT1132890	hsa-miR-2964a-3p	CLIP-seq
MIRT1132891	hsa-miR-302f	CLIP-seq
MIRT1132892	hsa-miR-3150a-5p	CLIP-seq
MIRT1132893	hsa-miR-3150b-5p	CLIP-seq
MIRT1132900	hsa-miR-4684-5p	CLIP-seq
MIRT1132901	hsa-miR-4768-3p	CLIP-seq
MIRT2267915	hsa-miR-548c-3p	CLIP-seq
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT1132890	hsa-miR-2964a-3p	CLIP-seq
MIRT1132891	hsa-miR-302f	CLIP-seq
MIRT1132892	hsa-miR-3150a-5p	CLIP-seq
MIRT1132893	hsa-miR-3150b-5p	CLIP-seq
MIRT1132898	hsa-miR-4321	CLIP-seq
MIRT1132900	hsa-miR-4684-5p	CLIP-seq
MIRT1132901	hsa-miR-4768-3p	CLIP-seq
MIRT1132902	hsa-miR-4781-5p	CLIP-seq
MIRT2267915	hsa-miR-548c-3p	CLIP-seq
MIRT2267912	hsa-miR-1227	CLIP-seq
MIRT1132889	hsa-miR-1273e	CLIP-seq
MIRT2267913	hsa-miR-194	CLIP-seq
MIRT1132890	hsa-miR-2964a-3p	CLIP-seq
MIRT1132891	hsa-miR-302f	CLIP-seq
MIRT1132892	hsa-miR-3150a-5p	CLIP-seq
MIRT1132893	hsa-miR-3150b-5p	CLIP-seq
MIRT1132898	hsa-miR-4321	CLIP-seq
MIRT1132900	hsa-miR-4684-5p	CLIP-seq
MIRT1132901	hsa-miR-4768-3p	CLIP-seq
MIRT1132902	hsa-miR-4781-5p	CLIP-seq
MIRT2267915	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20164257, 23239027, 26822058, 28661558, 32296183
GO:0005737	Component	Cytoplasm	IDA	23073616
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IDA	20164257, 23073616
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IMP	17186462
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	23073616
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	23073616
GO:0030054	Component	Cell junction	IDA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	20164257
GO:0033010	Component	Paranodal junction	IEA
GO:0043220	Component	Schmidt-Lanterman incisure	IEA
GO:0045216	Process	Cell-cell junction organization	IEA
GO:0045216	Process	Cell-cell junction organization	IMP	20164257
GO:0061028	Process	Establishment of endothelial barrier	IMP	23073616
GO:0061689	Component	Tricellular tight junction	IDA	28661558
GO:0061689	Component	Tricellular tight junction	IEA
GO:0070160	Component	Tight junction	IDA	23239027
GO:0070160	Component	Tight junction	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA
GO:0070830	Process	Bicellular tight junction assembly	IMP	20164257, 23073616

MIM	HGNC	e!Ensembl
610572	26401	ENSG00000152939

Q8N4S9

Protein name

MARVEL domain-containing protein 2 (Tricellulin)

Protein function

Plays a role in the formation of tricellular tight junctions and of epithelial barriers (By similarity). Required for normal hearing via its role in the separation of the endolymphatic and perilymphatic spaces of the organ of Corti in the inner

PDB

5N7H , 5N7I , 5N7K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01284	MARVEL	185 → 361	Membrane-associating domain	Domain
PF07303	Occludin_ELL	446 → 548	Occludin homology domain	Domain

Sequence

MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPD
FYSSDTEEPAIAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPAS
PARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYN
LRYSYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLG
SMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
FILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISAL
VCLKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMK
PELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVL
RKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIK
QRIQEYDKVMNWDVQGYS

Sequence length

558

Interactions

View interactions

	KEGG
	Tight junction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal recessive nonsyndromic hearing loss 49	Likely pathogenic; Pathogenic	rs2150915422, rs772030670, rs748896801, rs2150914115, rs200781822, rs1174369347, rs118203957, rs762352115, rs35496654, rs531073647, rs2150915254, rs772048719	RCV001822913 RCV001822914 RCV005635190 RCV001728010 RCV000001254 View all (7 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Deafness	Likely pathogenic; Pathogenic	rs1561299289	RCV000679820	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ear malformation	Likely pathogenic; Pathogenic	rs118203957	RCV001813930	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing impairment	Likely pathogenic; Pathogenic	rs770042200, rs772048719	RCV001375257 RCV001375176	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing loss, autosomal recessive	Likely pathogenic; Pathogenic	rs1561299289, rs1766596437	RCV001291457 RCV001291456	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Monogenic hearing loss	Likely pathogenic; Pathogenic	rs772048719	RCV006252572	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rare genetic deafness	Likely pathogenic; Pathogenic	rs118203957, rs762352115, rs531073647	RCV000156595 RCV000214632 RCV004018221	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOSOMAL RECESSIVE ISOLATED SENSORINEURAL DEAFNESS TYPE DFNB	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL EAR ANOMALY NOS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE 49	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ehlers-Danlos syndrome, spondylodysplastic type, 2	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARVELD2-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS OF BILATERAL EARS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	30140950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22394074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27957319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal recessive non-syndromic sensorineural deafness type DFNB	Non-Syndromic Sensorineural Deafness	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	22500027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24652413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	28586052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	25319490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	25467444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	29531219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28612843, 33789594	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33000262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29659773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33105684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	25885414	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DEAFNESS, AUTOSOMAL RECESSIVE 49	Deafness	BEFREE	17186462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE 49	Deafness	CLINVAR_DG	17186462, 23979167, 25652404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE 49	Deafness	GENOMICS_ENGLAND_DG	18084694		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE 49	Deafness	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing Loss	Hearing loss	Pubtator	18084694, 25885414, 29752989, 40244166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	25885414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	28623285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29934911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27641742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33000262	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22926991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21480761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	28623285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25755282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	15538632, 17186462, 18084694, 25217574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	CLINGEN_DG	17186462, 18084694, 22903915, 23979167, 25063198, 26677943, 27344577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27641742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	30140950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prelingual sensorineural hearing impairment	Sensorineural hearing loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20332670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20332670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28612843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Whipple Disease	Whipple disease	Pubtator	28176790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MARVELD2 (MARVEL domain containing 2)