Gene Gene information from NCBI Gene database.
Entrez ID 153527
Gene name Zinc finger matrin-type 2
Gene symbol ZMAT2
Synonyms (NCBI Gene)
Ptg-12Snu23
Chromosome 5
Chromosome location 5q31.3
miRNA miRNA information provided by mirtarbase database.
269
miRTarBase ID miRNA Experiments Reference
MIRT045065 hsa-miR-186-5p CLASH 23622248
MIRT630918 hsa-miR-6895-5p HITS-CLIP 23824327
MIRT630917 hsa-miR-764 HITS-CLIP 23824327
MIRT630916 hsa-miR-5693 HITS-CLIP 23824327
MIRT630915 hsa-miR-6499-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IDA 28781166
GO:0000398 Process MRNA splicing, via spliceosome IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619930 26433 ENSG00000146007
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96NC0
Protein name Zinc finger matrin-type protein 2
Protein function Involved in pre-mRNA splicing as a component of the spliceosome.
PDB 5O9Z , 6AHD , 7AAV , 7ABF , 7ABG , 7ABI , 8H6K , 8Q7N , 8QO9 , 8QPE , 8QZS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12171 zf-C2H2_jaz 79 105 Zinc-finger double-stranded RNA-binding Family
Sequence
MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY
Sequence length 199
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Spliceosome  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGENITAL RADIOULNAR SYNOSTOSIS GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Depressive Disorder Major depressive disorder Pubtator 34021117 Associate
★☆☆☆☆
Found in Text Mining only