Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	153443
Gene name	Serum response factor binding protein 1
Gene symbol	SRFBP1
Synonyms (NCBI Gene)	BUD22P49Rlb1STRAPp49/STRAP
Chromosome	5
Chromosome location	5q23.1

284

Show/Hide all (284)

miRTarBase ID	miRNA	Experiments	Reference
MIRT626189	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT626188	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT626187	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT626186	hsa-miR-1-5p	HITS-CLIP	23824327
MIRT626185	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT626184	hsa-miR-3672	HITS-CLIP	23824327
MIRT626183	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT626182	hsa-miR-8055	HITS-CLIP	23824327
MIRT626181	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT619742	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT619741	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT619740	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT619739	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT619738	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619737	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT560679	hsa-miR-5692a	PAR-CLIP	20371350
MIRT560678	hsa-miR-8066	PAR-CLIP	20371350
MIRT560677	hsa-miR-302f	PAR-CLIP	20371350
MIRT560676	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT560675	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT560674	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT560673	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT560672	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT560671	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT560670	hsa-miR-8068	PAR-CLIP	20371350
MIRT560669	hsa-miR-2054	PAR-CLIP	20371350
MIRT626189	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT626188	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT626187	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT626186	hsa-miR-1-5p	HITS-CLIP	23824327
MIRT626185	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT626184	hsa-miR-3672	HITS-CLIP	23824327
MIRT626183	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT626182	hsa-miR-8055	HITS-CLIP	23824327
MIRT626181	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT619742	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT619741	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT619740	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT619739	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT619738	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619737	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT560679	hsa-miR-5692a	PAR-CLIP	20371350
MIRT560678	hsa-miR-8066	PAR-CLIP	20371350
MIRT560677	hsa-miR-302f	PAR-CLIP	20371350
MIRT560676	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT560675	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT560674	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT560673	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT560672	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT560671	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT560670	hsa-miR-8068	PAR-CLIP	20371350
MIRT560669	hsa-miR-2054	PAR-CLIP	20371350
MIRT1388407	hsa-miR-1225-3p	CLIP-seq
MIRT1388408	hsa-miR-1233	CLIP-seq
MIRT1388409	hsa-miR-1304	CLIP-seq
MIRT1388410	hsa-miR-1827	CLIP-seq
MIRT1388411	hsa-miR-197	CLIP-seq
MIRT1388412	hsa-miR-2467-3p	CLIP-seq
MIRT1388413	hsa-miR-2467-5p	CLIP-seq
MIRT1388414	hsa-miR-298	CLIP-seq
MIRT1388415	hsa-miR-3148	CLIP-seq
MIRT1388416	hsa-miR-3160-3p	CLIP-seq
MIRT1388417	hsa-miR-3163	CLIP-seq
MIRT1388418	hsa-miR-3188	CLIP-seq
MIRT1388419	hsa-miR-3612	CLIP-seq
MIRT1388420	hsa-miR-3614-5p	CLIP-seq
MIRT1388421	hsa-miR-3678-3p	CLIP-seq
MIRT1388422	hsa-miR-3688-3p	CLIP-seq
MIRT1388423	hsa-miR-3689a-3p	CLIP-seq
MIRT1388424	hsa-miR-3689c	CLIP-seq
MIRT1388425	hsa-miR-369-3p	CLIP-seq
MIRT1388426	hsa-miR-374a	CLIP-seq
MIRT1388427	hsa-miR-374b	CLIP-seq
MIRT1388428	hsa-miR-3975	CLIP-seq
MIRT1388429	hsa-miR-411	CLIP-seq
MIRT1388430	hsa-miR-4257	CLIP-seq
MIRT1388431	hsa-miR-4282	CLIP-seq
MIRT1388432	hsa-miR-4421	CLIP-seq
MIRT1388433	hsa-miR-4423-5p	CLIP-seq
MIRT1388434	hsa-miR-4433	CLIP-seq
MIRT1388435	hsa-miR-4487	CLIP-seq
MIRT1388436	hsa-miR-4679	CLIP-seq
MIRT1388437	hsa-miR-4716-5p	CLIP-seq
MIRT1388438	hsa-miR-4728-5p	CLIP-seq
MIRT1388439	hsa-miR-485-5p	CLIP-seq
MIRT1388440	hsa-miR-5096	CLIP-seq
MIRT1388441	hsa-miR-548a-3p	CLIP-seq
MIRT1388442	hsa-miR-548e	CLIP-seq
MIRT1388443	hsa-miR-548f	CLIP-seq
MIRT1388444	hsa-miR-558	CLIP-seq
MIRT1388445	hsa-miR-561	CLIP-seq
MIRT1388446	hsa-miR-583	CLIP-seq
MIRT1388447	hsa-miR-650	CLIP-seq
MIRT1388448	hsa-miR-665	CLIP-seq
MIRT1388449	hsa-miR-889	CLIP-seq
MIRT1922403	hsa-miR-122	CLIP-seq
MIRT1922404	hsa-miR-24	CLIP-seq
MIRT1922405	hsa-miR-3135b	CLIP-seq
MIRT1922406	hsa-miR-3652	CLIP-seq
MIRT1922407	hsa-miR-4284	CLIP-seq
MIRT1922408	hsa-miR-4430	CLIP-seq
MIRT1922409	hsa-miR-4772-3p	CLIP-seq
MIRT2116368	hsa-miR-106a	CLIP-seq
MIRT2116369	hsa-miR-106b	CLIP-seq
MIRT1922403	hsa-miR-122	CLIP-seq
MIRT1388407	hsa-miR-1225-3p	CLIP-seq
MIRT1388408	hsa-miR-1233	CLIP-seq
MIRT2116370	hsa-miR-1285	CLIP-seq
MIRT1388409	hsa-miR-1304	CLIP-seq
MIRT2116371	hsa-miR-150	CLIP-seq
MIRT2116372	hsa-miR-17	CLIP-seq
MIRT2116373	hsa-miR-1915	CLIP-seq
MIRT2116374	hsa-miR-20a	CLIP-seq
MIRT2116375	hsa-miR-20b	CLIP-seq
MIRT1922404	hsa-miR-24	CLIP-seq
MIRT1388412	hsa-miR-2467-3p	CLIP-seq
MIRT1388413	hsa-miR-2467-5p	CLIP-seq
MIRT2116376	hsa-miR-302a	CLIP-seq
MIRT2116377	hsa-miR-302b	CLIP-seq
MIRT2116378	hsa-miR-302c	CLIP-seq
MIRT2116379	hsa-miR-302d	CLIP-seq
MIRT2116380	hsa-miR-302e	CLIP-seq
MIRT1922405	hsa-miR-3135b	CLIP-seq
MIRT2116381	hsa-miR-3187-5p	CLIP-seq
MIRT1388418	hsa-miR-3188	CLIP-seq
MIRT1388420	hsa-miR-3614-5p	CLIP-seq
MIRT1922406	hsa-miR-3652	CLIP-seq
MIRT1388423	hsa-miR-3689a-3p	CLIP-seq
MIRT1388424	hsa-miR-3689c	CLIP-seq
MIRT2116382	hsa-miR-372	CLIP-seq
MIRT2116383	hsa-miR-373	CLIP-seq
MIRT1388428	hsa-miR-3975	CLIP-seq
MIRT1388430	hsa-miR-4257	CLIP-seq
MIRT2116384	hsa-miR-4261	CLIP-seq
MIRT1922407	hsa-miR-4284	CLIP-seq
MIRT2116385	hsa-miR-433	CLIP-seq
MIRT1922408	hsa-miR-4430	CLIP-seq
MIRT1388434	hsa-miR-4433	CLIP-seq
MIRT2116386	hsa-miR-4496	CLIP-seq
MIRT2116387	hsa-miR-4726-3p	CLIP-seq
MIRT1388438	hsa-miR-4728-5p	CLIP-seq
MIRT1922409	hsa-miR-4772-3p	CLIP-seq
MIRT1388439	hsa-miR-485-5p	CLIP-seq
MIRT2116388	hsa-miR-494	CLIP-seq
MIRT2116389	hsa-miR-498	CLIP-seq
MIRT2116390	hsa-miR-512-3p	CLIP-seq
MIRT2116391	hsa-miR-519d	CLIP-seq
MIRT2116392	hsa-miR-520a-3p	CLIP-seq
MIRT2116393	hsa-miR-520b	CLIP-seq
MIRT2116394	hsa-miR-520c-3p	CLIP-seq
MIRT2116395	hsa-miR-520d-3p	CLIP-seq
MIRT2116396	hsa-miR-520e	CLIP-seq
MIRT2116397	hsa-miR-520g	CLIP-seq
MIRT2116398	hsa-miR-520h	CLIP-seq
MIRT2116399	hsa-miR-612	CLIP-seq
MIRT1388448	hsa-miR-665	CLIP-seq
MIRT2116400	hsa-miR-93	CLIP-seq
MIRT1922403	hsa-miR-122	CLIP-seq
MIRT1388407	hsa-miR-1225-3p	CLIP-seq
MIRT1388408	hsa-miR-1233	CLIP-seq
MIRT2338897	hsa-miR-129-3p	CLIP-seq
MIRT1388409	hsa-miR-1304	CLIP-seq
MIRT1388410	hsa-miR-1827	CLIP-seq
MIRT1388411	hsa-miR-197	CLIP-seq
MIRT1922404	hsa-miR-24	CLIP-seq
MIRT1388412	hsa-miR-2467-3p	CLIP-seq
MIRT1388413	hsa-miR-2467-5p	CLIP-seq
MIRT2338898	hsa-miR-3122	CLIP-seq
MIRT1922405	hsa-miR-3135b	CLIP-seq
MIRT1388416	hsa-miR-3160-3p	CLIP-seq
MIRT1388418	hsa-miR-3188	CLIP-seq
MIRT1388419	hsa-miR-3612	CLIP-seq
MIRT1388420	hsa-miR-3614-5p	CLIP-seq
MIRT1922406	hsa-miR-3652	CLIP-seq
MIRT1388423	hsa-miR-3689a-3p	CLIP-seq
MIRT1388424	hsa-miR-3689c	CLIP-seq
MIRT2338899	hsa-miR-3913-5p	CLIP-seq
MIRT1388428	hsa-miR-3975	CLIP-seq
MIRT1388429	hsa-miR-411	CLIP-seq
MIRT1388430	hsa-miR-4257	CLIP-seq
MIRT2116384	hsa-miR-4261	CLIP-seq
MIRT1922407	hsa-miR-4284	CLIP-seq
MIRT1388433	hsa-miR-4423-5p	CLIP-seq
MIRT1922408	hsa-miR-4430	CLIP-seq
MIRT1388434	hsa-miR-4433	CLIP-seq
MIRT1388435	hsa-miR-4487	CLIP-seq
MIRT1388436	hsa-miR-4679	CLIP-seq
MIRT1388437	hsa-miR-4716-5p	CLIP-seq
MIRT1388438	hsa-miR-4728-5p	CLIP-seq
MIRT1922409	hsa-miR-4772-3p	CLIP-seq
MIRT1388439	hsa-miR-485-5p	CLIP-seq
MIRT1388440	hsa-miR-5096	CLIP-seq
MIRT2338900	hsa-miR-554	CLIP-seq
MIRT1388444	hsa-miR-558	CLIP-seq
MIRT1388447	hsa-miR-650	CLIP-seq
MIRT1388448	hsa-miR-665	CLIP-seq
MIRT1388407	hsa-miR-1225-3p	CLIP-seq
MIRT1388408	hsa-miR-1233	CLIP-seq
MIRT1388409	hsa-miR-1304	CLIP-seq
MIRT1388411	hsa-miR-197	CLIP-seq
MIRT1388412	hsa-miR-2467-3p	CLIP-seq
MIRT1388413	hsa-miR-2467-5p	CLIP-seq
MIRT1388416	hsa-miR-3160-3p	CLIP-seq
MIRT1388418	hsa-miR-3188	CLIP-seq
MIRT2395155	hsa-miR-320a	CLIP-seq
MIRT2395156	hsa-miR-320b	CLIP-seq
MIRT2395157	hsa-miR-320c	CLIP-seq
MIRT2395158	hsa-miR-320d	CLIP-seq
MIRT2395159	hsa-miR-342-5p	CLIP-seq
MIRT1388420	hsa-miR-3614-5p	CLIP-seq
MIRT1388421	hsa-miR-3678-3p	CLIP-seq
MIRT1388423	hsa-miR-3689a-3p	CLIP-seq
MIRT1388424	hsa-miR-3689c	CLIP-seq
MIRT1388428	hsa-miR-3975	CLIP-seq
MIRT2395160	hsa-miR-4429	CLIP-seq
MIRT1388434	hsa-miR-4433	CLIP-seq
MIRT1388435	hsa-miR-4487	CLIP-seq
MIRT2395161	hsa-miR-4651	CLIP-seq
MIRT2395162	hsa-miR-4664-5p	CLIP-seq
MIRT1388436	hsa-miR-4679	CLIP-seq
MIRT1388438	hsa-miR-4728-5p	CLIP-seq
MIRT1388439	hsa-miR-485-5p	CLIP-seq
MIRT2395163	hsa-miR-539	CLIP-seq
MIRT1388444	hsa-miR-558	CLIP-seq
MIRT2395164	hsa-miR-608	CLIP-seq
MIRT2395165	hsa-miR-661	CLIP-seq
MIRT1388448	hsa-miR-665	CLIP-seq
MIRT1922403	hsa-miR-122	CLIP-seq
MIRT2116373	hsa-miR-1915	CLIP-seq
MIRT1922404	hsa-miR-24	CLIP-seq
MIRT1922405	hsa-miR-3135b	CLIP-seq
MIRT1922406	hsa-miR-3652	CLIP-seq
MIRT1922407	hsa-miR-4284	CLIP-seq
MIRT1922408	hsa-miR-4430	CLIP-seq
MIRT2116387	hsa-miR-4726-3p	CLIP-seq
MIRT1922409	hsa-miR-4772-3p	CLIP-seq
MIRT1922403	hsa-miR-122	CLIP-seq
MIRT1388407	hsa-miR-1225-3p	CLIP-seq
MIRT1388408	hsa-miR-1233	CLIP-seq
MIRT2338897	hsa-miR-129-3p	CLIP-seq
MIRT1388409	hsa-miR-1304	CLIP-seq
MIRT1388410	hsa-miR-1827	CLIP-seq
MIRT2116373	hsa-miR-1915	CLIP-seq
MIRT1922404	hsa-miR-24	CLIP-seq
MIRT1388413	hsa-miR-2467-5p	CLIP-seq
MIRT2338898	hsa-miR-3122	CLIP-seq
MIRT1922405	hsa-miR-3135b	CLIP-seq
MIRT1388418	hsa-miR-3188	CLIP-seq
MIRT1388419	hsa-miR-3612	CLIP-seq
MIRT1922406	hsa-miR-3652	CLIP-seq
MIRT1388423	hsa-miR-3689a-3p	CLIP-seq
MIRT1388424	hsa-miR-3689c	CLIP-seq
MIRT2338899	hsa-miR-3913-5p	CLIP-seq
MIRT1388428	hsa-miR-3975	CLIP-seq
MIRT1922407	hsa-miR-4284	CLIP-seq
MIRT1922408	hsa-miR-4430	CLIP-seq
MIRT1388434	hsa-miR-4433	CLIP-seq
MIRT2116387	hsa-miR-4726-3p	CLIP-seq
MIRT1388438	hsa-miR-4728-5p	CLIP-seq
MIRT1922409	hsa-miR-4772-3p	CLIP-seq
MIRT1388439	hsa-miR-485-5p	CLIP-seq
MIRT2116389	hsa-miR-498	CLIP-seq
MIRT2632363	hsa-miR-501-3p	CLIP-seq
MIRT2632364	hsa-miR-502-3p	CLIP-seq
MIRT1388447	hsa-miR-650	CLIP-seq
MIRT1388448	hsa-miR-665	CLIP-seq
MIRT1922403	hsa-miR-122	CLIP-seq
MIRT1388407	hsa-miR-1225-3p	CLIP-seq
MIRT1388408	hsa-miR-1233	CLIP-seq
MIRT1388409	hsa-miR-1304	CLIP-seq
MIRT2116373	hsa-miR-1915	CLIP-seq
MIRT1922404	hsa-miR-24	CLIP-seq
MIRT1388413	hsa-miR-2467-5p	CLIP-seq
MIRT1922405	hsa-miR-3135b	CLIP-seq
MIRT1388418	hsa-miR-3188	CLIP-seq
MIRT1922406	hsa-miR-3652	CLIP-seq
MIRT1388428	hsa-miR-3975	CLIP-seq
MIRT1922407	hsa-miR-4284	CLIP-seq
MIRT1922408	hsa-miR-4430	CLIP-seq
MIRT1388434	hsa-miR-4433	CLIP-seq
MIRT2116387	hsa-miR-4726-3p	CLIP-seq
MIRT1922409	hsa-miR-4772-3p	CLIP-seq
MIRT1388439	hsa-miR-485-5p	CLIP-seq
MIRT1388448	hsa-miR-665	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0030490	Process	Maturation of SSU-rRNA	IBA
GO:0030686	Component	90S preribosome	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

MIM	HGNC	e!Ensembl
610479	26333	ENSG00000151304

Q8NEF9

Protein name

Serum response factor-binding protein 1 (SRF-dependent transcription regulation-associated protein) (p49/STRAP)

Protein function

May be involved in regulating transcriptional activation of cardiac genes during the aging process. May play a role in biosynthesis and/or processing of SLC2A4 in adipose cells (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09073	BUD22	350 → 428	BUD22	Family

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in heart and skeletal muscle, and at much lower levels in brain and lung. {ECO:0000269|PubMed:15492011}.

Sequence

MAQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTEDALLKNQRRAQRLLE
EIHAMKELKPDIVTKSALGDDINFEKIFKKPDSTATERAIARLAVHPLLKKKIDVLKAAV
QAFKEARQNVAEVESSKNASEDNHSENTLYSNDNGSNLQREATVISEQKVKETKILAKKP
IHNSKEKIAKMEHGPKAVTIANSPSKPSEKDSVVSLESQKTPADPKLKTLSQTKKNKGSD
SSLSGNSDGGEEFCEEEKEYFDDSTEERFYKQSSMSEDSDSGDDFFIGKVRRTRKKESSC
HSSVKEQKPLEKVFLKEDTGETHGDTRNDKIKPSTETRKLESVFFHSLSGSKSSRRNFKE
QAPKTRSLDFPQNEPQIKNQFNKKLSGRLENTKQQLQLPLHPSWEASRRRKEQQSNIAVF
QGKKITFDD

Sequence length

429

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AORTIC ANEURYSM, FAMILIAL THORACIC 10	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANEURYSM OF ASCENDING AORTA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTIS LAXA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION, AORTIC ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL THORACIC AORTIC ANEURYSM AND AORTIC DISSECTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16778189, 26781266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17316412		★★★★★ ★☆☆☆☆ Found in Text Mining only
AORTIC ANEURYSM, FAMILIAL THORACIC 10	Aortic Aneurysm	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	10646843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16778189, 29797604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26212323, 36581319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15720808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17108118, 17316412, 28827371, 29783958, 30257989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15720808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15720808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17316412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital aneurysm of ascending aorta	Congenital Aneurysm Of Ascending Aorta	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma	Ewing sarcoma	BEFREE	17108118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	CLINVAR_DG	26838787, 27432961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	Pubtator	36833422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	36833422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	36833422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26212323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29283497, 30257989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10646843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30257989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17108118, 29797604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29849900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	28436936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	29046333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29283497, 29849900, 30276452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35272839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	20954180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30276452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	20954180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SRFBP1 (serum response factor binding protein 1)