Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	152926
Gene name	Protein phosphatase, Mg2+/Mn2+ dependent 1K
Gene symbol	PPM1K
Synonyms (NCBI Gene)	BCKDHBDPMSUDMVPP2CkappaPP2CmPTMPUG0882E07
Chromosome	4
Chromosome location	4q22.1
Summary	This gene encodes a member of the PPM family of Mn2+/Mg2+-dependent protein phosphatases. The encoded protein, essential for cell survival and development, is targeted to the mitochondria where it plays a key role in regulation of the mitochondrial permea

458

Show/Hide all (458)

miRTarBase ID	miRNA	Experiments	Reference
MIRT715656	hsa-miR-5571-5p	HITS-CLIP	19536157
MIRT715655	hsa-miR-668-3p	HITS-CLIP	19536157
MIRT715654	hsa-miR-2681-5p	HITS-CLIP	19536157
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT654852	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT654851	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT654850	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT654849	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT654848	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT654847	hsa-miR-1976	HITS-CLIP	23824327
MIRT654846	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT622623	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT622623	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT622623	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT715656	hsa-miR-5571-5p	PAR-CLIP	27292025
MIRT715656	hsa-miR-5571-5p	HITS-CLIP	19536157
MIRT715655	hsa-miR-668-3p	HITS-CLIP	19536157
MIRT715654	hsa-miR-2681-5p	HITS-CLIP	19536157
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT654852	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT654851	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT654850	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT654849	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT654848	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT654847	hsa-miR-1976	HITS-CLIP	23824327
MIRT654846	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT622623	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT622623	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT622625	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT622624	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT622622	hsa-miR-8061	HITS-CLIP	23824327
MIRT622623	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT1254541	hsa-miR-106a	CLIP-seq
MIRT1254542	hsa-miR-106b	CLIP-seq
MIRT1254543	hsa-miR-1200	CLIP-seq
MIRT1254544	hsa-miR-1224-3p	CLIP-seq
MIRT1254545	hsa-miR-1245b-3p	CLIP-seq
MIRT1254546	hsa-miR-1270	CLIP-seq
MIRT1254547	hsa-miR-1272	CLIP-seq
MIRT1254548	hsa-miR-1276	CLIP-seq
MIRT1254549	hsa-miR-1279	CLIP-seq
MIRT1254550	hsa-miR-1290	CLIP-seq
MIRT1254551	hsa-miR-1299	CLIP-seq
MIRT1254552	hsa-miR-1322	CLIP-seq
MIRT1254553	hsa-miR-140-5p	CLIP-seq
MIRT1254554	hsa-miR-17	CLIP-seq
MIRT1254555	hsa-miR-1914	CLIP-seq
MIRT1254556	hsa-miR-203	CLIP-seq
MIRT1254557	hsa-miR-20a	CLIP-seq
MIRT1254558	hsa-miR-20b	CLIP-seq
MIRT1254559	hsa-miR-23a	CLIP-seq
MIRT1254560	hsa-miR-23b	CLIP-seq
MIRT1254561	hsa-miR-23c	CLIP-seq
MIRT1254562	hsa-miR-28-3p	CLIP-seq
MIRT1254563	hsa-miR-299-5p	CLIP-seq
MIRT1254564	hsa-miR-302a	CLIP-seq
MIRT1254565	hsa-miR-302b	CLIP-seq
MIRT1254566	hsa-miR-302c	CLIP-seq
MIRT1254567	hsa-miR-302d	CLIP-seq
MIRT1254568	hsa-miR-302e	CLIP-seq
MIRT1254569	hsa-miR-3117-5p	CLIP-seq
MIRT1254570	hsa-miR-3120-3p	CLIP-seq
MIRT1254571	hsa-miR-3148	CLIP-seq
MIRT1254572	hsa-miR-371-5p	CLIP-seq
MIRT1254573	hsa-miR-371b-5p	CLIP-seq
MIRT1254574	hsa-miR-372	CLIP-seq
MIRT1254575	hsa-miR-373	CLIP-seq
MIRT1254576	hsa-miR-3941	CLIP-seq
MIRT1254577	hsa-miR-3973	CLIP-seq
MIRT1254578	hsa-miR-4282	CLIP-seq
MIRT1254579	hsa-miR-4307	CLIP-seq
MIRT1254580	hsa-miR-4311	CLIP-seq
MIRT1254581	hsa-miR-432	CLIP-seq
MIRT1254582	hsa-miR-4330	CLIP-seq
MIRT1254583	hsa-miR-4432	CLIP-seq
MIRT1254584	hsa-miR-4434	CLIP-seq
MIRT1254585	hsa-miR-4438	CLIP-seq
MIRT1254586	hsa-miR-4452	CLIP-seq
MIRT1254587	hsa-miR-4477a	CLIP-seq
MIRT1254588	hsa-miR-4477b	CLIP-seq
MIRT1254589	hsa-miR-4516	CLIP-seq
MIRT1254590	hsa-miR-4517	CLIP-seq
MIRT1254591	hsa-miR-4531	CLIP-seq
MIRT1254592	hsa-miR-4635	CLIP-seq
MIRT1254593	hsa-miR-4639-3p	CLIP-seq
MIRT1254594	hsa-miR-4643	CLIP-seq
MIRT1254595	hsa-miR-466	CLIP-seq
MIRT1254596	hsa-miR-4666-5p	CLIP-seq
MIRT1254597	hsa-miR-4672	CLIP-seq
MIRT1254598	hsa-miR-4683	CLIP-seq
MIRT1254599	hsa-miR-4694-3p	CLIP-seq
MIRT1254600	hsa-miR-4698	CLIP-seq
MIRT1254601	hsa-miR-4729	CLIP-seq
MIRT1254602	hsa-miR-4731-5p	CLIP-seq
MIRT1254603	hsa-miR-4757-5p	CLIP-seq
MIRT1254604	hsa-miR-4789-3p	CLIP-seq
MIRT1254605	hsa-miR-4803	CLIP-seq
MIRT1254606	hsa-miR-5095	CLIP-seq
MIRT1254607	hsa-miR-512-3p	CLIP-seq
MIRT1254608	hsa-miR-512-5p	CLIP-seq
MIRT1254609	hsa-miR-519d	CLIP-seq
MIRT1254610	hsa-miR-520a-3p	CLIP-seq
MIRT1254611	hsa-miR-520b	CLIP-seq
MIRT1254612	hsa-miR-520c-3p	CLIP-seq
MIRT1254613	hsa-miR-520d-3p	CLIP-seq
MIRT1254614	hsa-miR-520e	CLIP-seq
MIRT1254615	hsa-miR-520g	CLIP-seq
MIRT1254616	hsa-miR-520h	CLIP-seq
MIRT1254617	hsa-miR-545	CLIP-seq
MIRT1254618	hsa-miR-548ae	CLIP-seq
MIRT1254619	hsa-miR-548aj	CLIP-seq
MIRT1254620	hsa-miR-548am	CLIP-seq
MIRT1254621	hsa-miR-548x	CLIP-seq
MIRT1254622	hsa-miR-577	CLIP-seq
MIRT1254623	hsa-miR-583	CLIP-seq
MIRT1254624	hsa-miR-606	CLIP-seq
MIRT1254625	hsa-miR-620	CLIP-seq
MIRT1254626	hsa-miR-7	CLIP-seq
MIRT1254627	hsa-miR-875-3p	CLIP-seq
MIRT1254628	hsa-miR-890	CLIP-seq
MIRT1254629	hsa-miR-93	CLIP-seq
MIRT1254573	hsa-miR-371b-5p	CLIP-seq
MIRT2075123	hsa-miR-122	CLIP-seq
MIRT1254548	hsa-miR-1276	CLIP-seq
MIRT1254550	hsa-miR-1290	CLIP-seq
MIRT2075124	hsa-miR-130a	CLIP-seq
MIRT2075125	hsa-miR-130b	CLIP-seq
MIRT2075126	hsa-miR-2052	CLIP-seq
MIRT1254562	hsa-miR-28-3p	CLIP-seq
MIRT2075127	hsa-miR-301a	CLIP-seq
MIRT2075128	hsa-miR-301b	CLIP-seq
MIRT2075129	hsa-miR-3135b	CLIP-seq
MIRT2075130	hsa-miR-3185	CLIP-seq
MIRT2075131	hsa-miR-3613-3p	CLIP-seq
MIRT2075132	hsa-miR-3652	CLIP-seq
MIRT2075133	hsa-miR-3666	CLIP-seq
MIRT2075134	hsa-miR-4295	CLIP-seq
MIRT2075135	hsa-miR-4430	CLIP-seq
MIRT2075136	hsa-miR-4511	CLIP-seq
MIRT2075137	hsa-miR-454	CLIP-seq
MIRT1254594	hsa-miR-4643	CLIP-seq
MIRT2075138	hsa-miR-4653-3p	CLIP-seq
MIRT1254595	hsa-miR-466	CLIP-seq
MIRT1254596	hsa-miR-4666-5p	CLIP-seq
MIRT1254600	hsa-miR-4698	CLIP-seq
MIRT2075139	hsa-miR-4709-3p	CLIP-seq
MIRT2075140	hsa-miR-4715-3p	CLIP-seq
MIRT1254604	hsa-miR-4789-3p	CLIP-seq
MIRT1254541	hsa-miR-106a	CLIP-seq
MIRT1254542	hsa-miR-106b	CLIP-seq
MIRT2075123	hsa-miR-122	CLIP-seq
MIRT1254544	hsa-miR-1224-3p	CLIP-seq
MIRT2301734	hsa-miR-128	CLIP-seq
MIRT2301735	hsa-miR-1297	CLIP-seq
MIRT2075124	hsa-miR-130a	CLIP-seq
MIRT2075125	hsa-miR-130b	CLIP-seq
MIRT2301736	hsa-miR-1343	CLIP-seq
MIRT1254554	hsa-miR-17	CLIP-seq
MIRT1254555	hsa-miR-1914	CLIP-seq
MIRT2301737	hsa-miR-197	CLIP-seq
MIRT1254556	hsa-miR-203	CLIP-seq
MIRT1254557	hsa-miR-20a	CLIP-seq
MIRT1254558	hsa-miR-20b	CLIP-seq
MIRT1254559	hsa-miR-23a	CLIP-seq
MIRT1254560	hsa-miR-23b	CLIP-seq
MIRT1254561	hsa-miR-23c	CLIP-seq
MIRT2301738	hsa-miR-26a	CLIP-seq
MIRT2301739	hsa-miR-26b	CLIP-seq
MIRT2301740	hsa-miR-27a	CLIP-seq
MIRT2301741	hsa-miR-27b	CLIP-seq
MIRT1254562	hsa-miR-28-3p	CLIP-seq
MIRT2075127	hsa-miR-301a	CLIP-seq
MIRT2075128	hsa-miR-301b	CLIP-seq
MIRT1254564	hsa-miR-302a	CLIP-seq
MIRT1254565	hsa-miR-302b	CLIP-seq
MIRT1254566	hsa-miR-302c	CLIP-seq
MIRT1254567	hsa-miR-302d	CLIP-seq
MIRT1254568	hsa-miR-302e	CLIP-seq
MIRT1254569	hsa-miR-3117-5p	CLIP-seq
MIRT1254570	hsa-miR-3120-3p	CLIP-seq
MIRT2301742	hsa-miR-3124-3p	CLIP-seq
MIRT2075129	hsa-miR-3135b	CLIP-seq
MIRT2301743	hsa-miR-3187-3p	CLIP-seq
MIRT2301744	hsa-miR-342-3p	CLIP-seq
MIRT2301745	hsa-miR-3622b-5p	CLIP-seq
MIRT2075132	hsa-miR-3652	CLIP-seq
MIRT2301746	hsa-miR-3663-5p	CLIP-seq
MIRT2075133	hsa-miR-3666	CLIP-seq
MIRT2301747	hsa-miR-3680	CLIP-seq
MIRT1254572	hsa-miR-371-5p	CLIP-seq
MIRT1254573	hsa-miR-371b-5p	CLIP-seq
MIRT1254574	hsa-miR-372	CLIP-seq
MIRT1254575	hsa-miR-373	CLIP-seq
MIRT2301748	hsa-miR-377	CLIP-seq
MIRT2301749	hsa-miR-3920	CLIP-seq
MIRT1254576	hsa-miR-3941	CLIP-seq
MIRT1254577	hsa-miR-3973	CLIP-seq
MIRT2301750	hsa-miR-410	CLIP-seq
MIRT2301751	hsa-miR-4274	CLIP-seq
MIRT2075134	hsa-miR-4295	CLIP-seq
MIRT1254579	hsa-miR-4307	CLIP-seq
MIRT2075135	hsa-miR-4430	CLIP-seq
MIRT1254583	hsa-miR-4432	CLIP-seq
MIRT1254584	hsa-miR-4434	CLIP-seq
MIRT2301752	hsa-miR-4435	CLIP-seq
MIRT1254585	hsa-miR-4438	CLIP-seq
MIRT1254586	hsa-miR-4452	CLIP-seq
MIRT2301753	hsa-miR-4465	CLIP-seq
MIRT2075136	hsa-miR-4511	CLIP-seq
MIRT1254589	hsa-miR-4516	CLIP-seq
MIRT2301754	hsa-miR-4519	CLIP-seq
MIRT1254591	hsa-miR-4531	CLIP-seq
MIRT2301755	hsa-miR-4536	CLIP-seq
MIRT2075137	hsa-miR-454	CLIP-seq
MIRT1254592	hsa-miR-4635	CLIP-seq
MIRT1254593	hsa-miR-4639-3p	CLIP-seq
MIRT1254594	hsa-miR-4643	CLIP-seq
MIRT2301756	hsa-miR-4652-3p	CLIP-seq
MIRT1254595	hsa-miR-466	CLIP-seq
MIRT1254596	hsa-miR-4666-5p	CLIP-seq
MIRT1254597	hsa-miR-4672	CLIP-seq
MIRT1254599	hsa-miR-4694-3p	CLIP-seq
MIRT2301757	hsa-miR-4701-5p	CLIP-seq
MIRT2301758	hsa-miR-4704-3p	CLIP-seq
MIRT2301759	hsa-miR-4716-5p	CLIP-seq
MIRT1254602	hsa-miR-4731-5p	CLIP-seq
MIRT2301760	hsa-miR-4755-3p	CLIP-seq
MIRT1254603	hsa-miR-4757-5p	CLIP-seq
MIRT2301761	hsa-miR-4772-3p	CLIP-seq
MIRT2301762	hsa-miR-4775	CLIP-seq
MIRT2301763	hsa-miR-4781-3p	CLIP-seq
MIRT1254604	hsa-miR-4789-3p	CLIP-seq
MIRT2301764	hsa-miR-4795-3p	CLIP-seq
MIRT2301765	hsa-miR-4796-5p	CLIP-seq
MIRT2301766	hsa-miR-4798-3p	CLIP-seq
MIRT2301767	hsa-miR-495	CLIP-seq
MIRT2301768	hsa-miR-499-3p	CLIP-seq
MIRT2301769	hsa-miR-499a-3p	CLIP-seq
MIRT1254606	hsa-miR-5095	CLIP-seq
MIRT2301770	hsa-miR-5096	CLIP-seq
MIRT1254607	hsa-miR-512-3p	CLIP-seq
MIRT1254608	hsa-miR-512-5p	CLIP-seq
MIRT1254609	hsa-miR-519d	CLIP-seq
MIRT1254610	hsa-miR-520a-3p	CLIP-seq
MIRT1254611	hsa-miR-520b	CLIP-seq
MIRT1254612	hsa-miR-520c-3p	CLIP-seq
MIRT1254613	hsa-miR-520d-3p	CLIP-seq
MIRT1254614	hsa-miR-520e	CLIP-seq
MIRT1254615	hsa-miR-520g	CLIP-seq
MIRT1254616	hsa-miR-520h	CLIP-seq
MIRT1254617	hsa-miR-545	CLIP-seq
MIRT2301771	hsa-miR-548s	CLIP-seq
MIRT2301772	hsa-miR-548u	CLIP-seq
MIRT1254622	hsa-miR-577	CLIP-seq
MIRT2301773	hsa-miR-579	CLIP-seq
MIRT2301774	hsa-miR-587	CLIP-seq
MIRT2301775	hsa-miR-588	CLIP-seq
MIRT2301776	hsa-miR-654-3p	CLIP-seq
MIRT1254626	hsa-miR-7	CLIP-seq
MIRT1254629	hsa-miR-93	CLIP-seq
MIRT2301755	hsa-miR-4536	CLIP-seq
MIRT1254550	hsa-miR-1290	CLIP-seq
MIRT2301734	hsa-miR-128	CLIP-seq
MIRT2301740	hsa-miR-27a	CLIP-seq
MIRT2301741	hsa-miR-27b	CLIP-seq
MIRT1254594	hsa-miR-4643	CLIP-seq
MIRT1254595	hsa-miR-466	CLIP-seq
MIRT1254604	hsa-miR-4789-3p	CLIP-seq
MIRT2075123	hsa-miR-122	CLIP-seq
MIRT2075124	hsa-miR-130a	CLIP-seq
MIRT2075125	hsa-miR-130b	CLIP-seq
MIRT2075127	hsa-miR-301a	CLIP-seq
MIRT2075128	hsa-miR-301b	CLIP-seq
MIRT2075129	hsa-miR-3135b	CLIP-seq
MIRT2457049	hsa-miR-346	CLIP-seq
MIRT2301745	hsa-miR-3622b-5p	CLIP-seq
MIRT2075132	hsa-miR-3652	CLIP-seq
MIRT2075133	hsa-miR-3666	CLIP-seq
MIRT2457050	hsa-miR-3934	CLIP-seq
MIRT2457051	hsa-miR-4288	CLIP-seq
MIRT2075134	hsa-miR-4295	CLIP-seq
MIRT2075135	hsa-miR-4430	CLIP-seq
MIRT2075137	hsa-miR-454	CLIP-seq
MIRT2075140	hsa-miR-4715-3p	CLIP-seq
MIRT2457052	hsa-miR-4727-5p	CLIP-seq
MIRT2457053	hsa-miR-4769-3p	CLIP-seq
MIRT1254606	hsa-miR-5095	CLIP-seq
MIRT2457054	hsa-miR-552	CLIP-seq
MIRT2457055	hsa-miR-632	CLIP-seq
MIRT2598480	hsa-miR-105	CLIP-seq
MIRT2075123	hsa-miR-122	CLIP-seq
MIRT2598481	hsa-miR-1238	CLIP-seq
MIRT2598482	hsa-miR-1258	CLIP-seq
MIRT1254547	hsa-miR-1272	CLIP-seq
MIRT2598483	hsa-miR-1273d	CLIP-seq
MIRT2301734	hsa-miR-128	CLIP-seq
MIRT2301735	hsa-miR-1297	CLIP-seq
MIRT1254551	hsa-miR-1299	CLIP-seq
MIRT2075124	hsa-miR-130a	CLIP-seq
MIRT2075125	hsa-miR-130b	CLIP-seq
MIRT1254552	hsa-miR-1322	CLIP-seq
MIRT2301736	hsa-miR-1343	CLIP-seq
MIRT2598484	hsa-miR-147b	CLIP-seq
MIRT2598485	hsa-miR-186	CLIP-seq
MIRT2075126	hsa-miR-2052	CLIP-seq
MIRT2598486	hsa-miR-210	CLIP-seq
MIRT2598487	hsa-miR-22	CLIP-seq
MIRT2301738	hsa-miR-26a	CLIP-seq
MIRT2301739	hsa-miR-26b	CLIP-seq
MIRT2301740	hsa-miR-27a	CLIP-seq
MIRT2301741	hsa-miR-27b	CLIP-seq
MIRT2075127	hsa-miR-301a	CLIP-seq
MIRT2075128	hsa-miR-301b	CLIP-seq
MIRT1254569	hsa-miR-3117-5p	CLIP-seq
MIRT2301742	hsa-miR-3124-3p	CLIP-seq
MIRT2598488	hsa-miR-3133	CLIP-seq
MIRT2075129	hsa-miR-3135b	CLIP-seq
MIRT1254571	hsa-miR-3148	CLIP-seq
MIRT2598489	hsa-miR-3174	CLIP-seq
MIRT2075130	hsa-miR-3185	CLIP-seq
MIRT2075131	hsa-miR-3613-3p	CLIP-seq
MIRT2598490	hsa-miR-361-5p	CLIP-seq
MIRT2301745	hsa-miR-3622b-5p	CLIP-seq
MIRT2598491	hsa-miR-3646	CLIP-seq
MIRT2075132	hsa-miR-3652	CLIP-seq
MIRT2598492	hsa-miR-3662	CLIP-seq
MIRT2075133	hsa-miR-3666	CLIP-seq
MIRT2598493	hsa-miR-3671	CLIP-seq
MIRT2598494	hsa-miR-3713	CLIP-seq
MIRT2598495	hsa-miR-4266	CLIP-seq
MIRT2598496	hsa-miR-4276	CLIP-seq
MIRT1254578	hsa-miR-4282	CLIP-seq
MIRT2075134	hsa-miR-4295	CLIP-seq
MIRT2598497	hsa-miR-4328	CLIP-seq
MIRT2598498	hsa-miR-4424	CLIP-seq
MIRT2075135	hsa-miR-4430	CLIP-seq
MIRT1254583	hsa-miR-4432	CLIP-seq
MIRT2301753	hsa-miR-4465	CLIP-seq
MIRT1254587	hsa-miR-4477a	CLIP-seq
MIRT2075136	hsa-miR-4511	CLIP-seq
MIRT1254590	hsa-miR-4517	CLIP-seq
MIRT2075137	hsa-miR-454	CLIP-seq
MIRT1254593	hsa-miR-4639-3p	CLIP-seq
MIRT1254594	hsa-miR-4643	CLIP-seq
MIRT1254595	hsa-miR-466	CLIP-seq
MIRT2598499	hsa-miR-4684-3p	CLIP-seq
MIRT2075139	hsa-miR-4709-3p	CLIP-seq
MIRT2075140	hsa-miR-4715-3p	CLIP-seq
MIRT2598500	hsa-miR-4724-5p	CLIP-seq
MIRT1254601	hsa-miR-4729	CLIP-seq
MIRT1254604	hsa-miR-4789-3p	CLIP-seq
MIRT1254605	hsa-miR-4803	CLIP-seq
MIRT2598501	hsa-miR-489	CLIP-seq
MIRT2301767	hsa-miR-495	CLIP-seq
MIRT2598502	hsa-miR-526b	CLIP-seq
MIRT2598503	hsa-miR-548a-3p	CLIP-seq
MIRT1254618	hsa-miR-548ae	CLIP-seq
MIRT1254619	hsa-miR-548aj	CLIP-seq
MIRT1254620	hsa-miR-548am	CLIP-seq
MIRT2598504	hsa-miR-548c-3p	CLIP-seq
MIRT2598505	hsa-miR-548e	CLIP-seq
MIRT2598506	hsa-miR-548f	CLIP-seq
MIRT2598507	hsa-miR-548g	CLIP-seq
MIRT2301772	hsa-miR-548u	CLIP-seq
MIRT1254621	hsa-miR-548x	CLIP-seq
MIRT2598508	hsa-miR-578	CLIP-seq
MIRT2301773	hsa-miR-579	CLIP-seq
MIRT2301774	hsa-miR-587	CLIP-seq
MIRT2598509	hsa-miR-607	CLIP-seq
MIRT2598510	hsa-miR-769-5p	CLIP-seq
MIRT1254627	hsa-miR-875-3p	CLIP-seq
MIRT2598511	hsa-miR-921	CLIP-seq
MIRT2598512	hsa-miR-924	CLIP-seq
MIRT2598513	hsa-miR-933	CLIP-seq
MIRT2598514	hsa-miR-944	CLIP-seq
MIRT2075123	hsa-miR-122	CLIP-seq
MIRT2598482	hsa-miR-1258	CLIP-seq
MIRT1254547	hsa-miR-1272	CLIP-seq
MIRT2301734	hsa-miR-128	CLIP-seq
MIRT2301735	hsa-miR-1297	CLIP-seq
MIRT1254551	hsa-miR-1299	CLIP-seq
MIRT2075124	hsa-miR-130a	CLIP-seq
MIRT2075125	hsa-miR-130b	CLIP-seq
MIRT1254552	hsa-miR-1322	CLIP-seq
MIRT2301736	hsa-miR-1343	CLIP-seq
MIRT2598484	hsa-miR-147b	CLIP-seq
MIRT2598486	hsa-miR-210	CLIP-seq
MIRT2301738	hsa-miR-26a	CLIP-seq
MIRT2301739	hsa-miR-26b	CLIP-seq
MIRT2301740	hsa-miR-27a	CLIP-seq
MIRT2301741	hsa-miR-27b	CLIP-seq
MIRT2075127	hsa-miR-301a	CLIP-seq
MIRT2075128	hsa-miR-301b	CLIP-seq
MIRT1254569	hsa-miR-3117-5p	CLIP-seq
MIRT2301742	hsa-miR-3124-3p	CLIP-seq
MIRT2075129	hsa-miR-3135b	CLIP-seq
MIRT1254571	hsa-miR-3148	CLIP-seq
MIRT2598489	hsa-miR-3174	CLIP-seq
MIRT2598490	hsa-miR-361-5p	CLIP-seq
MIRT2301745	hsa-miR-3622b-5p	CLIP-seq
MIRT2075132	hsa-miR-3652	CLIP-seq
MIRT2075133	hsa-miR-3666	CLIP-seq
MIRT2598494	hsa-miR-3713	CLIP-seq
MIRT2598495	hsa-miR-4266	CLIP-seq
MIRT2598496	hsa-miR-4276	CLIP-seq
MIRT1254578	hsa-miR-4282	CLIP-seq
MIRT2075134	hsa-miR-4295	CLIP-seq
MIRT2598497	hsa-miR-4328	CLIP-seq
MIRT2598498	hsa-miR-4424	CLIP-seq
MIRT2075135	hsa-miR-4430	CLIP-seq
MIRT1254583	hsa-miR-4432	CLIP-seq
MIRT2301753	hsa-miR-4465	CLIP-seq
MIRT1254590	hsa-miR-4517	CLIP-seq
MIRT2075137	hsa-miR-454	CLIP-seq
MIRT1254593	hsa-miR-4639-3p	CLIP-seq
MIRT1254594	hsa-miR-4643	CLIP-seq
MIRT1254595	hsa-miR-466	CLIP-seq
MIRT2598500	hsa-miR-4724-5p	CLIP-seq
MIRT1254604	hsa-miR-4789-3p	CLIP-seq
MIRT1254605	hsa-miR-4803	CLIP-seq
MIRT2598501	hsa-miR-489	CLIP-seq
MIRT2598502	hsa-miR-526b	CLIP-seq
MIRT2598503	hsa-miR-548a-3p	CLIP-seq
MIRT1254618	hsa-miR-548ae	CLIP-seq
MIRT1254619	hsa-miR-548aj	CLIP-seq
MIRT1254620	hsa-miR-548am	CLIP-seq
MIRT2598505	hsa-miR-548e	CLIP-seq
MIRT2598506	hsa-miR-548f	CLIP-seq
MIRT2598507	hsa-miR-548g	CLIP-seq
MIRT2301772	hsa-miR-548u	CLIP-seq
MIRT1254621	hsa-miR-548x	CLIP-seq
MIRT2598508	hsa-miR-578	CLIP-seq
MIRT2301773	hsa-miR-579	CLIP-seq
MIRT2301774	hsa-miR-587	CLIP-seq
MIRT2598510	hsa-miR-769-5p	CLIP-seq
MIRT1254627	hsa-miR-875-3p	CLIP-seq
MIRT1254628	hsa-miR-890	CLIP-seq
MIRT2598511	hsa-miR-921	CLIP-seq
MIRT2598513	hsa-miR-933	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	17374715, 22291014, 29779826
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	TAS
GO:0005515	Function	Protein binding	IPI	22291014, 25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	ISS
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0009083	Process	Branched-chain amino acid catabolic process	IMP	29779826
GO:0016787	Function	Hydrolase activity	IEA
GO:0030145	Function	Manganese ion binding	IDA	22291014
GO:0043169	Function	Cation binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047385	Function	[3-methyl-2-oxobutanoate dehydrogenase (lipoamide)]-phosphatase activity	IEA
GO:1902108	Process	Regulation of mitochondrial membrane permeability involved in apoptotic process	IEA
GO:1902531	Process	Regulation of intracellular signal transduction	IBA

MIM	HGNC	e!Ensembl
611065	25415	ENSG00000163644

Q8N3J5

Protein name

Protein phosphatase Mn(2+)-dependent 1K (EC 3.1.3.16) (Branched-chain alpha-ketoacid dehydrogenase phosphatase) (BCKDH) (BDP) (EC 3.1.3.52) (PP2C domain-containing protein phosphatase 1K) (PP2C-like mitochondrial protein) (PP2C-type mitochondrial phosphop

Protein function

Serine/threonine-protein phosphatase component of macronutrients metabolism. Forms a functional kinase and phosphatase pair with BCKDK, serving as a metabolic regulatory node that coordinates branched-chain amino acids (BCAAs) with glucose and l

PDB

2IQ1 , 4DA1 , 6AK7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00481	PP2C	96 → 339	Protein phosphatase 2C	Family

Sequence

MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPAT
WDNFGIWDNRIDEPILLPPSIKYGKPIPKISLENVGCASQIGKRKENEDRFDFAQLTDEV
LYFAVYDGHGGPAAADFCHTHMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSAD
ATLLTSGTTATVALLRDGIELVVASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKC
GGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPETKRIKLHHADDSFLVLTTDGI
NFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFS
FSRSFASSGRWA

Sequence length

372

Interactions

View interactions

	Reactome
			Branched-chain amino acid catabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Maple syrup urine disease, mild variant	Pathogenic	rs2476675975	RCV004556889	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONDUCT DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERMEDIATE MAPLE SYRUP URINE DISEASE	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPLE SYRUP URINE DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPM1K-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (45)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29429593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	28852838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29768190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar I disorder	Bipolar Disorder	BEFREE	31634753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchospasm	Bronchospasm	BEFREE	30586199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36417878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23376929	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36417878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	31805718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31546610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30451284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30451284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Classic Maple Syrup Urine Disease	Maple Syrup Urine Disease	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36104170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	28852838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	21210099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21210099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	31738932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31738932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28768654, 30451284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29369529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29779826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	31340305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21210099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28768654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intermediate Maple Syrup Urine Disease	Maple Syrup Urine Disease	ORPHANET_DG	23086801		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intermediate maple syrup urine disease	Maple Syrup Urine Disease	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intermediate Maple Syrup Urine Disease	Maple Syrup Urine Disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intermittent Maple Syrup Urine Disease	Maple Syrup Urine Disease	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29719258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23376929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	BEFREE	21210099, 23086801		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Maple Syrup Urine Disease	Maple syrup urine disease	Pubtator	30451284	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Maple Syrup Urine Disease	Maple Syrup Urine Disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPLE SYRUP URINE DISEASE, MILD VARIANT	Maple Syrup Urine Disease	GENOMICS_ENGLAND_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Maple Syrup Urine Disease, Thiamine Responsive	Maple Syrup Urine Disease	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30451284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31634753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30537300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31634753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10446990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	29768190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29768190, 30025790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29779826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	31340305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPM1K (protein phosphatase, Mg2+/Mn2+ dependent 1K)