SHISA3 (shisa family member 3)

Gene

• Entrez ID: 152573
• Gene name: Shisa family member 3
• Gene symbol: SHISA3
• Synonyms (NCBI Gene): hShisa3
• Chromosome: 4
• Chromosome location: 4p13
• Summary: This gene encodes a single-transmembrane protein which is one of nine members of a family of transmembrane adaptors that modulate both WNT and FGF signaling by blocking the maturation and transport of their receptors to the cell surface. Members of this f

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1346886	hsa-miR-101	CLIP-seq
MIRT1346887	hsa-miR-144	CLIP-seq
MIRT1346888	hsa-miR-18a	CLIP-seq
MIRT1346889	hsa-miR-18b	CLIP-seq
MIRT1346890	hsa-miR-3154	CLIP-seq
MIRT1346891	hsa-miR-3671	CLIP-seq
MIRT1346892	hsa-miR-4735-3p	CLIP-seq
MIRT1346893	hsa-miR-582-5p	CLIP-seq
MIRT1346894	hsa-miR-607	CLIP-seq
MIRT2327145	hsa-miR-450b-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA

Other IDs

• MIM: 617325
• HGNC: 25159
• e!Ensembl: ENSG00000178343

Protein

• UniProt ID: A0PJX4
• Protein name: Protein shisa-3 homolog
• Protein function: Plays an essential role in the maturation of presomitic mesoderm cells by individual attenuation of both FGF and WNT signaling.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13908	Shisa	25 → 202	Wnt and FGF inhibitory regulator	Family

• Sequence:

  MRALLALCLLLGWLRWGPAGAQQSGEYCHGWVDVQGNYHEGFQCPEDFDTLDATICCGSC
  ALRYCCAAADARLEQGGCTNDRRELEHPGITAQPVYVPFLIVGSIFIAFIILGSVVAIYC
  CTCLRPKEPSQQPIRFSLRSYQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSF
  ARAEPGCLVPSPPPPYTTSHSIHLAQPSGFLVSPQYFAYPLQQEPPLPGKSCPDFSSS

• Sequence length: 238

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31801598		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32692756	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33642344	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25036006, 25968618, 31222549		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28639485		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25968618		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33642344	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25036006, 25968618, 31222549		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31801598		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28716111, 32324312	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30573520		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25036006, 25968618, 30573520		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25036006		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28299336	Associate	★☆☆☆☆ Found in Text Mining only