Gene Gene information from NCBI Gene database.
Entrez ID 1525
Gene name CXADR cell adhesion molecule
Gene symbol CXADR
Synonyms (NCBI Gene)
CARCAR4/6HCAR
Chromosome 21
Chromosome location 21q21.1
Summary The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosom
miRNA miRNA information provided by mirtarbase database.
591
miRTarBase ID miRNA Experiments Reference
MIRT020061 hsa-miR-375 Microarray 20215506
MIRT030352 hsa-miR-26b-5p Microarray 19088304
MIRT043740 hsa-miR-342-3p CLASH 23622248
MIRT038505 hsa-miR-296-3p CLASH 23622248
MIRT917564 hsa-miR-1245b-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Transcription factor Regulation Reference
SNAI1 Repression 10487759
SNAI2 Repression 10487759
SP1 Unknown 22190856
ZEB1 Repression 10487759
ZEB2 Repression 10487759
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
62
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0001669 Component Acrosomal vesicle ISS
GO:0005102 Function Signaling receptor binding IPI 14978041
GO:0005178 Function Integrin binding IPI 12869515
GO:0005515 Function Protein binding IPI 11734628, 17675666, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602621 2559 ENSG00000154639
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P78310
Protein name Coxsackievirus and adenovirus receptor (CAR) (hCAR) (CVB3-binding protein) (Coxsackievirus B-adenovirus receptor) (HCVADR)
Protein function Component of the epithelial apical junction complex that may function as a homophilic cell adhesion molecule and is essential for tight junction integrity. Also involved in transepithelial migration of leukocytes through adhesive interactions wi
PDB 1EAJ , 1F5W , 1JEW , 1KAC , 1P69 , 1P6A , 1RSF , 2J12 , 2J1K , 2NPL , 2W9L , 2WBW , 3J6L , 3J6M , 3J6N , 3J6O , 7DPZ , 7DQ1 , 7VXZ , 7VYK , 7VYL , 7VYM , 7W14
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 23 138 Immunoglobulin V-set domain Domain
PF00047 ig 149 225 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is fo
Sequence
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS
PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC
KVKKAPGVANKKIHLVVL
VKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLL
RLNVVPPSNKAGLIA
GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK
DGSIV
Sequence length 365
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Virion - Adenovirus
Cell adhesion molecules
Viral myocarditis
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATRIAL FIBRILLATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Cerebrovascular Accidents Stroke BEFREE 24368200
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 31571160, 31671855
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 27009300, 27865176, 28888074, 28988742, 29288188, 29417201, 29633386, 29716633, 29797659, 30006739, 30120708, 30539476, 30651858, 30666425, 31282760
View all (3 more)
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 25174587
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 17031523
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 31640756
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 21468049, 31028190
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 29633386, 30006739, 30120708, 30666425, 31335716, 31554741
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 30006739, 30735463
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 30632631
★☆☆☆☆
Found in Text Mining only