Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	152485
Gene name	Zinc finger protein 827
Gene symbol	ZNF827
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q31.21-q31.22

149

Show/Hide all (149)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019011	hsa-miR-335-5p	Microarray	18185580
MIRT051198	hsa-miR-16-5p	CLASH	23622248
MIRT532825	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT532825	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT532824	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT532822	hsa-miR-4643	PAR-CLIP	22012620
MIRT532823	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT532820	hsa-miR-4744	PAR-CLIP	22012620
MIRT532821	hsa-miR-466	PAR-CLIP	22012620
MIRT532819	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT532818	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT532817	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT462939	hsa-miR-4311	PAR-CLIP	23592263
MIRT462938	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462937	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462936	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462935	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT462934	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT462933	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT462932	hsa-miR-3153	PAR-CLIP	23592263
MIRT462931	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT462930	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT439179	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439179	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT532825	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT532825	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT532824	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT532822	hsa-miR-4643	PAR-CLIP	22012620
MIRT532823	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT532820	hsa-miR-4744	PAR-CLIP	22012620
MIRT532821	hsa-miR-466	PAR-CLIP	22012620
MIRT532819	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT532818	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT532817	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT462939	hsa-miR-4311	PAR-CLIP	23592263
MIRT462938	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462937	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462936	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462935	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT462934	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT462933	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT462932	hsa-miR-3153	PAR-CLIP	23592263
MIRT462931	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT462930	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT1541411	hsa-miR-1324	CLIP-seq
MIRT1541412	hsa-miR-3926	CLIP-seq
MIRT1541413	hsa-miR-4290	CLIP-seq
MIRT1541414	hsa-miR-4493	CLIP-seq
MIRT1541415	hsa-miR-4649-3p	CLIP-seq
MIRT1541416	hsa-miR-4658	CLIP-seq
MIRT1541417	hsa-miR-4728-5p	CLIP-seq
MIRT1541418	hsa-miR-4753-5p	CLIP-seq
MIRT1541419	hsa-miR-4758-5p	CLIP-seq
MIRT1541420	hsa-miR-542-5p	CLIP-seq
MIRT1541421	hsa-miR-604	CLIP-seq
MIRT1541422	hsa-miR-622	CLIP-seq
MIRT1541423	hsa-miR-647	CLIP-seq
MIRT2163401	hsa-miR-2355-3p	CLIP-seq
MIRT2163402	hsa-miR-3655	CLIP-seq
MIRT2163403	hsa-miR-3909	CLIP-seq
MIRT2163404	hsa-miR-4508	CLIP-seq
MIRT2163405	hsa-miR-578	CLIP-seq
MIRT2163406	hsa-miR-676	CLIP-seq
MIRT2382594	hsa-miR-1301	CLIP-seq
MIRT2382595	hsa-miR-1827	CLIP-seq
MIRT2382596	hsa-miR-22	CLIP-seq
MIRT2382597	hsa-miR-3137	CLIP-seq
MIRT2382598	hsa-miR-3166	CLIP-seq
MIRT2382599	hsa-miR-3190	CLIP-seq
MIRT2382600	hsa-miR-3192	CLIP-seq
MIRT2382601	hsa-miR-3202	CLIP-seq
MIRT2382602	hsa-miR-3612	CLIP-seq
MIRT2382603	hsa-miR-3689a-3p	CLIP-seq
MIRT2382604	hsa-miR-3689c	CLIP-seq
MIRT2382605	hsa-miR-4327	CLIP-seq
MIRT2382606	hsa-miR-4533	CLIP-seq
MIRT2382607	hsa-miR-4660	CLIP-seq
MIRT1541417	hsa-miR-4728-5p	CLIP-seq
MIRT2382608	hsa-miR-4793-3p	CLIP-seq
MIRT2382609	hsa-miR-5047	CLIP-seq
MIRT2382610	hsa-miR-650	CLIP-seq
MIRT2397751	hsa-miR-142-3p	CLIP-seq
MIRT2464721	hsa-miR-1262	CLIP-seq
MIRT2464722	hsa-miR-3184	CLIP-seq
MIRT2464723	hsa-miR-3659	CLIP-seq
MIRT2464724	hsa-miR-423-5p	CLIP-seq
MIRT2464725	hsa-miR-4701-3p	CLIP-seq
MIRT2464726	hsa-miR-4710	CLIP-seq
MIRT2464727	hsa-miR-4731-5p	CLIP-seq
MIRT2673314	hsa-miR-1248	CLIP-seq
MIRT2464721	hsa-miR-1262	CLIP-seq
MIRT2673315	hsa-miR-1268	CLIP-seq
MIRT2673316	hsa-miR-1268b	CLIP-seq
MIRT2673317	hsa-miR-1275	CLIP-seq
MIRT2163401	hsa-miR-2355-3p	CLIP-seq
MIRT2673318	hsa-miR-296-5p	CLIP-seq
MIRT2673319	hsa-miR-3175	CLIP-seq
MIRT2464722	hsa-miR-3184	CLIP-seq
MIRT2673320	hsa-miR-3189-3p	CLIP-seq
MIRT2673321	hsa-miR-3652	CLIP-seq
MIRT2163402	hsa-miR-3655	CLIP-seq
MIRT2464723	hsa-miR-3659	CLIP-seq
MIRT2673322	hsa-miR-3665	CLIP-seq
MIRT2163403	hsa-miR-3909	CLIP-seq
MIRT2673323	hsa-miR-3944-5p	CLIP-seq
MIRT2673324	hsa-miR-3977	CLIP-seq
MIRT2464724	hsa-miR-423-5p	CLIP-seq
MIRT2673325	hsa-miR-4300	CLIP-seq
MIRT2673326	hsa-miR-4430	CLIP-seq
MIRT2673327	hsa-miR-4488	CLIP-seq
MIRT2673328	hsa-miR-4492	CLIP-seq
MIRT2673329	hsa-miR-4497	CLIP-seq
MIRT2673330	hsa-miR-4498	CLIP-seq
MIRT2673331	hsa-miR-4638-3p	CLIP-seq
MIRT2673332	hsa-miR-4665-5p	CLIP-seq
MIRT2673333	hsa-miR-4697-5p	CLIP-seq
MIRT2464725	hsa-miR-4701-3p	CLIP-seq
MIRT2464726	hsa-miR-4710	CLIP-seq
MIRT2464727	hsa-miR-4731-5p	CLIP-seq
MIRT2673334	hsa-miR-4733-3p	CLIP-seq
MIRT2673335	hsa-miR-4768-3p	CLIP-seq
MIRT2673336	hsa-miR-4781-5p	CLIP-seq
MIRT2673337	hsa-miR-502-5p	CLIP-seq
MIRT2163405	hsa-miR-578	CLIP-seq
MIRT2673338	hsa-miR-581	CLIP-seq
MIRT2673339	hsa-miR-657	CLIP-seq
MIRT2673340	hsa-miR-665	CLIP-seq
MIRT2673341	hsa-miR-671-3p	CLIP-seq
MIRT2163406	hsa-miR-676	CLIP-seq
MIRT2673342	hsa-miR-744	CLIP-seq
MIRT2673343	hsa-miR-762	CLIP-seq
MIRT2673344	hsa-miR-920	CLIP-seq
MIRT2464721	hsa-miR-1262	CLIP-seq
MIRT2673318	hsa-miR-296-5p	CLIP-seq
MIRT2673319	hsa-miR-3175	CLIP-seq
MIRT2464722	hsa-miR-3184	CLIP-seq
MIRT2464723	hsa-miR-3659	CLIP-seq
MIRT2464724	hsa-miR-423-5p	CLIP-seq
MIRT2673325	hsa-miR-4300	CLIP-seq
MIRT2673329	hsa-miR-4497	CLIP-seq
MIRT2464725	hsa-miR-4701-3p	CLIP-seq
MIRT2464726	hsa-miR-4710	CLIP-seq
MIRT2464727	hsa-miR-4731-5p	CLIP-seq
MIRT2673334	hsa-miR-4733-3p	CLIP-seq
MIRT2673335	hsa-miR-4768-3p	CLIP-seq
MIRT2673336	hsa-miR-4781-5p	CLIP-seq
MIRT2673340	hsa-miR-665	CLIP-seq
MIRT2673342	hsa-miR-744	CLIP-seq
MIRT2673344	hsa-miR-920	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	IMP	25150861
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861, 30045876
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000785	Component	Chromatin	IDA	33174841
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25150861, 30045876, 32296183, 33174841
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0006338	Process	Chromatin remodeling	IMP	25150861
GO:0008270	Function	Zinc ion binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	33174841
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070200	Process	Establishment of protein localization to telomere	IMP	25150861, 30045876
GO:0120325	Function	NuRD complex binding	IDA	25150861
GO:1904791	Process	Negative regulation of shelterin complex assembly	IMP	25150861
GO:1990904	Component	Ribonucleoprotein complex	IDA	33174841

MIM	HGNC	e!Ensembl
617962	27193	ENSG00000151612

Q17R98

Protein name

Zinc finger protein 827

Protein function

As part of a ribonucleoprotein complex composed at least of HNRNPK, HNRNPL and the circular RNA circZNF827 that nucleates the complex on chromatin, may negatively regulate the transcription of genes involved in neuronal differentiation (PubMed:3

PDB

5XXQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	374 → 396	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	402 → 424	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	817 → 839	Zinc finger, C2H2 type	Domain

Sequence

MPRRKQEQPKRLPSHVSRQEEAEGELSEGEHWYGNSSETPSEASYGEVQENYKLSLEDRI
QEQSTSPDTSLGSTTPSSHTLELVALDSEVLRDSLQCQDHLSPGVSSLCDDDPGSNKPLS
SNLRRLLEAGSLKLDAAATANGRVESPVNVGSNLSFSPPSHHAQQLSVLARKLAEKQEQN
DQYTPSNRFIWNQGKWLPNSTTTCSLSPDSAILKLKAAANAVLQDKSLTRTEETMRFESF
SSPFSSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEVAARAAG
SLLAEKSSLLPEDPLPPPPSEKKPEKVTPPPPPPPPPPPPPPPQSLELLLLPVPKGRVSK
PSNSASEEESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKSH
MKVHQHQDRGETFQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPDPDVKGSPHL
SDSACLGQQREGGGTELVGTMMTSNTPERTSQGGAGVSPLLVKEEPKEDNGLPTSFTLNA
ADRPANHTKLKDPSEYVANSASALFSQDISVKMASDFLMKLSAANQKEPMNLNFKVKEEP
KEGESLSTTLPRSSYVFSPESEVSAPGVSEDALKPQEGKGSVLRRDVSVKAASELLMKLS
AESYKETQMVKIKEEPMEVDIQDSHVSISPSRNVGYSTLIGREKTEPLQKMPEGRVPPER
NLFSQDISVKMASELLFQLSEKVSKEHNHTKENTIRTTTSPFFSEDTFRQSPFTSNSKEL
LPSDSVLHGRISAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLHT
EERKYKCHLCPYAAKCRANLNQHLTVHSVKLVSTDTEDIVSAVTSEGSDGKKHPYYYSCH
VCGFETELNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTP
SESNSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMPGSQPSLNSEEKPEKGFE
CVFCNFVCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNSGQ
W

Sequence length

1081

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autism spectrum disorder	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GWASDB_DG	22843504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	28399120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30557370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31673075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF827 (zinc finger protein 827)