CX3CR1 (C-X3-C motif chemokine receptor 1)

Gene

• Entrez ID: 1524
• Gene name: C-X3-C motif chemokine receptor 1
• Gene symbol: CX3CR1
• Synonyms (NCBI Gene): CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28
• Chromosome: 3
• Chromosome location: 3p22.2
• Summary: Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs3732378	G>A	Protective, risk-factor, pathogenic	Coding sequence variant, missense variant
rs3732379	C>T	Protective, risk-factor, pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT917546	hsa-miR-1207-5p	CLIP-seq
MIRT917547	hsa-miR-1236	CLIP-seq
MIRT917548	hsa-miR-127-5p	CLIP-seq
MIRT917549	hsa-miR-204	CLIP-seq
MIRT917550	hsa-miR-211	CLIP-seq
MIRT917551	hsa-miR-3155	CLIP-seq
MIRT917552	hsa-miR-3155b	CLIP-seq
MIRT917553	hsa-miR-3163	CLIP-seq
MIRT917554	hsa-miR-3168	CLIP-seq
MIRT917555	hsa-miR-3924	CLIP-seq
MIRT917556	hsa-miR-4446-5p	CLIP-seq
MIRT917557	hsa-miR-4496	CLIP-seq
MIRT917558	hsa-miR-4639-5p	CLIP-seq
MIRT917559	hsa-miR-4738-3p	CLIP-seq
MIRT917560	hsa-miR-4755-5p	CLIP-seq
MIRT917561	hsa-miR-4763-3p	CLIP-seq
MIRT917562	hsa-miR-484	CLIP-seq
MIRT917563	hsa-miR-623	CLIP-seq
MIRT2465153	hsa-miR-3125	CLIP-seq
MIRT2465154	hsa-miR-3916	CLIP-seq
MIRT2465155	hsa-miR-570	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	ISS
GO:0002282	Process	Microglial cell activation involved in immune response	IEA
GO:0002282	Process	Microglial cell activation involved in immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	ISS
GO:0004950	Function	Chemokine receptor activity	TAS	10754298
GO:0005515	Function	Protein binding	IPI	9931005, 32296183
GO:0005886	Component	Plasma membrane	IDA	12055230
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9390561
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IGI	16019082
GO:0006935	Process	Chemotaxis	TAS	10754298
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	ISS
GO:0006968	Process	Cellular defense response	TAS	10754298
GO:0007155	Process	Cell adhesion	IDA	9782118
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0007155	Process	Cell adhesion	TAS	10754298
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10754298
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007267	Process	Cell-cell signaling	TAS	24352739
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	TAS	24352739
GO:0009611	Process	Response to wounding	TAS	10754298
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	28791023
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS	10415068
GO:0009986	Component	Cell surface	TAS	24352739
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016495	Function	C-X3-C chemokine receptor activity	IDA	9782118, 12055230
GO:0016495	Function	C-X3-C chemokine receptor activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019960	Function	C-X3-C chemokine binding	IDA	23125415
GO:0019960	Function	C-X3-C chemokine binding	IEA
GO:0019960	Function	C-X3-C chemokine binding	ISS
GO:0021626	Process	Central nervous system maturation	IEA
GO:0021626	Process	Central nervous system maturation	ISS
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0030595	Process	Leukocyte chemotaxis	ISS
GO:0031737	Function	CX3C chemokine receptor binding	IDA	9782118
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	ISS
GO:0032691	Process	Negative regulation of interleukin-1 beta production	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0035176	Process	Social behavior	IEA
GO:0035176	Process	Social behavior	ISS
GO:0035425	Process	Autocrine signaling	ISS
GO:0043005	Component	Neuron projection	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0045087	Process	Innate immune response	IC	23499256
GO:0045087	Process	Innate immune response	IEA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	IEA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	ISS
GO:0048167	Process	Regulation of synaptic plasticity	TAS	24352739
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048874	Process	Host-mediated modulation of intestinal microbiota composition	IEA
GO:0048874	Process	Host-mediated modulation of intestinal microbiota composition	ISS
GO:0050767	Process	Regulation of neurogenesis	TAS	24352739
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	ISS
GO:0050901	Process	Leukocyte tethering or rolling	IEA
GO:0050901	Process	Leukocyte tethering or rolling	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060074	Process	Synapse maturation	IEA
GO:0060074	Process	Synapse maturation	ISS
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061760	Process	Antifungal innate immune response	IEA
GO:0061760	Process	Antifungal innate immune response	IMP	29326275
GO:0061760	Process	Antifungal innate immune response	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IEA
GO:0097447	Component	Dendritic tree	ISS
GO:0098883	Process	Synapse pruning	IC
GO:0098883	Process	Synapse pruning	IEA
GO:0098883	Process	Synapse pruning	ISS
GO:0110091	Process	Negative regulation of hippocampal neuron apoptotic process	ISS
GO:0150090	Process	Multiple spine synapse organization, single dendrite	IEA
GO:0150090	Process	Multiple spine synapse organization, single dendrite	ISS
GO:0160056	Component	Macropinosome membrane	TAS
GO:1904139	Process	Regulation of microglial cell migration	TAS	24352739
GO:1904150	Process	Negative regulation of microglial cell mediated cytotoxicity	IEA
GO:1904150	Process	Negative regulation of microglial cell mediated cytotoxicity	ISS
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	ISS

Other IDs

• MIM: 601470
• HGNC: 2558
• e!Ensembl: ENSG00000168329

Protein

• UniProt ID: P49238
• Protein name: CX3C chemokine receptor 1 (C-X3-C CKR-1) (CX3CR1) (Beta chemokine receptor-like 1) (CMK-BRL-1) (CMK-BRL1) (Fractalkine receptor) (G-protein coupled receptor 13) (V28)
• Protein function: Receptor for the C-X3-C chemokine fractalkine (CX3CL1) present on many early leukocyte cells; CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis
• PDB: 7XBW, 7XBX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	48 → 293	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lymphoid and neural tissues (PubMed:7590284). Expressed in lymphocyte subsets, such as natural killer (NK) cells, gamma-delta T-cells and terminally differentiated CD8(+) T-cells (PubMed:12055230). Expressed in smooth musc
• Sequence:

  MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK
  KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI
  TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP
  EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF
  FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
  RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

• Sequence length: 355

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Efferocytosis

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Age related macular degeneration 12	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHLORACNE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease, susceptibility to, 1	Uncertain significance	ClinVar ClinVar, Disgenet ClinVar, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CX3CR1-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION, AGE-RELATED, 12	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	12697743, 15886814, 30381070		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	15886814		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	24718616		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18974152		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26633537		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23857671		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	28619710		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34220331	Associate	★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	17900259		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	17900259		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	15208270, 15944936, 17652758, 17909623, 17909628, 20206286, 20361964, 20538655, 21126357, 21273533, 21621535, 22816662, 24287500, 24664727, 25050486, 26305531, 26464724, 26476672, 29360187, 29565837, 30160348, 31288713		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	15208270		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36189598, 36405736	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	28343297		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	21771791		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24806473, 28342179, 30352020, 30607245		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	24806473, 28342179, 28973548	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	25105870, 37175630	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	24528288	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	20019415	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	31765724		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24084767, 28986258		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	16524739		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	16524739	Inhibit	★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	16524739	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	18296082	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	33531038, 36341412	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	18296082		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	30810667	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11532900, 15017357, 15644279, 16480760, 16675737, 16908772, 17456471, 17673719, 17885215, 19840952, 21492740, 21525510, 22897138, 23029475, 23887641, 23974513, 25221380, 25845619, 27118566, 28234900, 28302649, 28842393, 29641559, 30830865		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	32884948	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11762935, 15880821, 17471309, 17665439	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12428227	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15038835, 19223978, 20523302, 26107373	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	17082760, 17505143, 18615095, 20523302		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	17082760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	20184883		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11264153, 11532900, 12697743, 14990582, 15944936, 17456471, 19840952, 20019415, 21525510, 21873805, 22313962, 32107839, 32229536, 32686027	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11532900, 12697743, 15017357, 15644279, 16480760, 16675737, 16908772, 17456471, 17673719, 17885215, 19840952, 21492740, 21525510, 22897138, 23029475, 23887641, 23974513, 25221380, 25845619, 27118566, 28234900, 28302649, 28842393, 29641559, 30830865		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16908772, 17456471		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24307998	Inhibit	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28763059	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28763059		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24528288	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	18060687, 26448050		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	27703039	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	15681302		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	19755791	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31524247		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20630606, 30310518		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35294039, 37040163	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	16645504		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25926643, 40051011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19309748, 30628679		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22064656, 33819196	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	38241595	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26633537, 31077234		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	35618744	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	12846758		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	12846758	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12697743, 12846758, 14990582, 15644279, 19628406, 29356931, 31139667		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12697743, 12846758, 14990582, 32229536	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	19755791	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	16675737, 19372452		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	19755791, 28677375	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	31652730		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	19755791	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	22748631, 29545116		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15681302, 22748631, 28061814, 29323156, 30628839		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	15681302		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	15644279, 15681302		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	BEFREE	15726664		★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	7646814		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12846758, 21132346, 28596556		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23663527, 25830914		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21771791, 29939299		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22990622, 29909020, 30668715		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17611763, 28691930		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17611763		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35140706, 38572984	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	23716478, 27176135, 29126427		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18585734, 24336891		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	11264153	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11264153, 12697743, 15017357, 16224053, 17329566, 18609106, 19439304, 19628406, 22731642, 22897138, 27013693		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11264153, 11532900, 15017357, 15886814, 16224053, 16480760, 17329566, 18609106, 19439304, 19628406, 20523302, 22731642, 22897138, 25221380, 25845619, 27013693		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11264153, 11532900, 20523302, 34794330	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	16224053, 18609106		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20523302	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	12697743	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	27013693	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	11264153, 15017357, 16224053, 17329566, 18609106, 19439304, 19628406, 22731642, 22897138, 27013693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	16405540, 16405541, 18617779, 28842393		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	18617779		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19000946	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24556958, 29217163, 29268768		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	25105870	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31765724		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	15131578, 26976687		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15131578	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	15131578		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24821910		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28763059	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	23716478, 27176135	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	BEFREE	28650342		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11264153		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11264153, 22897138, 27118566		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11264153, 23956503, 25105870	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21525510, 28128806	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21525510, 22897138		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36092962, 36969169	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29190915		★☆☆☆☆ Found in Text Mining only
Disorder of macula of retina	Disorder Of Macula Of Retina	BEFREE	24142887		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24821910		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	22377584, 27902351		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30622457		★☆☆☆☆ Found in Text Mining only
Eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	7646814		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30079598		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	20538655, 29360187		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30150990		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18078680, 21038415		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	22816662		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28747747		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	39436725	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19001328, 20184883, 24859792, 25987130		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35327982	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19001328, 25987130		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20146987, 20184883, 20630606, 26856327		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20511186	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	22572859	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	22892858	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	20206286, 21621535, 29360187		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	17579663	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18585734		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	22572859, 22892858	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25926643	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	22902395, 30228352		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22902395, 30228352		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20206286		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28302649		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	39436725	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16584113		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27118566, 30207169		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24270813, 31077234, 35186183	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32922201, 35222428	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	22572859, 28196748		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	23663527	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	18519809		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11535497		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21771791, 29939299, 31765724		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17241867, 29743615	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28842393, 30668715		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	15131578, 26976687		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21525510	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	35833148	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28044051		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	19755791	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	15644279, 30043461, 31771656		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	12110009		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12110009	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22572859		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	24177428		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	33672355	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12846758, 21132346, 27118566, 28596556		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27258612, 29720577, 36064206	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29720577		★☆☆☆☆ Found in Text Mining only
Leukocytoclastic vasculitis	Leukocytoclastic Vasculitis	BEFREE	23470165		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12076860, 15809764		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18078680		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	21636249	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	22550960		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28228284		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28228284	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	31744836		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	18772344		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19309748, 37770496	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15934075, 26395317	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33665864	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30537116		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	30537116	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	17900259		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18060687		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18060687		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35887224	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	20038229		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	15208270, 15944936, 17057786, 24287500, 25503251, 26464724, 29565837, 33604378	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	21273533, 35352887	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular degeneration	Macular Degeneration	BEFREE	24287500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	29565837	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION, AGE-RELATED, 12	Age-Related Macular Degeneration	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	20184883		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30310518		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19309748, 30628679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26633537, 31077234		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28845524		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18060687, 30066854		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25482732		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19923448, 20184883, 20630606, 23388733, 24799766, 25482732, 26633537, 28619710, 29446734, 29655283, 29669928		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31378907		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23229614		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31765724		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	27013693, 36865544	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22897138		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29669928		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	18194290		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21820915		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	26348210		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	18561120		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25962684, 30845779		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14533779, 22261545, 22916723, 24175290, 26469270, 28842393, 30386211, 30671738		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16144955		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21320123	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25596452		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	29850876	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27481108	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16224053, 19628406, 23887641, 24307998, 27013693, 30586712		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24307998, 27013693	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28800592		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	27209190		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14612547, 17611763, 19001328, 22699780, 22941344, 24084767, 25482732, 25987130, 28691930, 29234059, 29669928, 31741765		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28810923, 30496784		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20630606		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24799766, 28264694, 29361745		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28763059		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Age-related macular degeneration	Age-related macular degeneration	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19309748		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20523302, 21525510, 28650582		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20523302, 38175171	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	36921085	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	19302240, 32884948, 37962028	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	35785145	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 6	Osteogenesis imperfecta	Pubtator	16524739	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31780870		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26633537		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31077234		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22064656, 26633537, 31077234, 35777713	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28845524		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24084767, 28986258		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29274778	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	29274778	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	19153557	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	19153557		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	22335964	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22747084, 26469270, 29624735		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	15730397	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	12535747		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31726181		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31726181		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	12535747		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	LHGDN	12535747		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	30948201		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28943292		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15726664, 21636249		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	15726664		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18060687, 30066854		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15256432, 19155311		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	40121536	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	15131578	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	17002687, 26976687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	16584113, 34252346	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31419078	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	18772344		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29203799		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33665864	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	26107373	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31288713		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31652020		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11465708, 12889997, 19923448, 22709495, 27484962, 28912865, 30366278		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17471309, 17804530		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	14657873		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	17982926	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	22984568		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	22984568	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28763059, 31739114		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	28763059	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	15608300	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15608300, 16584113	Associate	★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	29239897		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26160897		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29655283, 36171070	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35003322, 37082943	Associate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29024334, 31704966		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	16224053		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25482732		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24764683	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30117729, 31746472		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	20920788, 25833819, 30769286		★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	30628839		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	36674940	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37040163	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22101184, 26042517, 28842393		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	37042831	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	11532900	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	15608300	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	23470165, 28912865		★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	23470165		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28464004		★☆☆☆☆ Found in Text Mining only