CMTM8 (CKLF like MARVEL transmembrane domain containing 8)

Gene

• Entrez ID: 152189
• Gene name: CKLF like MARVEL transmembrane domain containing 8
• Gene symbol: CMTM8
• Synonyms (NCBI Gene): CKLFSF8, CKLFSF8-V2
• Chromosome: 3
• Chromosome location: 3p22.3
• Summary: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037344	hsa-miR-877-5p	CLASH	23622248
MIRT899213	hsa-miR-3144-3p	CLIP-seq
MIRT899214	hsa-miR-4528	CLIP-seq
MIRT899215	hsa-miR-4693-3p	CLIP-seq
MIRT899216	hsa-miR-4698	CLIP-seq
MIRT899217	hsa-miR-522	CLIP-seq
MIRT899218	hsa-miR-582-5p	CLIP-seq
MIRT899219	hsa-miR-875-5p	CLIP-seq
MIRT899220	hsa-miR-924	CLIP-seq
MIRT899221	hsa-miR-944	CLIP-seq
MIRT2202512	hsa-miR-145	CLIP-seq
MIRT2202513	hsa-miR-194	CLIP-seq
MIRT2202514	hsa-miR-495	CLIP-seq
MIRT2202515	hsa-miR-513c	CLIP-seq
MIRT2202516	hsa-miR-514	CLIP-seq
MIRT2202517	hsa-miR-514b-3p	CLIP-seq
MIRT2202518	hsa-miR-514b-5p	CLIP-seq
MIRT2202519	hsa-miR-642b	CLIP-seq
MIRT899213	hsa-miR-3144-3p	CLIP-seq
MIRT2386272	hsa-miR-323-3p	CLIP-seq
MIRT899214	hsa-miR-4528	CLIP-seq
MIRT899219	hsa-miR-875-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0019911	Function	Structural constituent of myelin sheath	IBA
GO:0042552	Process	Myelination	IBA

Other IDs

• MIM: 607891
• HGNC: 19179
• e!Ensembl: ENSG00000170293

Protein

• UniProt ID: Q8IZV2
• Protein name: CKLF-like MARVEL transmembrane domain-containing protein 8 (Chemokine-like factor superfamily member 8)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01284	MARVEL	36 → 162	Membrane-associating domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in liver and pancreas. {ECO:0000269|PubMed:12782130}.
• Sequence:

  MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIA
  GTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYL
  SAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ

• Sequence length: 173

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	21654738	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	21654738	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26503336, 26615421		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26574634		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22337876, 36975415	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26503336, 26615421		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35429970	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26503336, 26615421		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26503336		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25551557, 26503336, 26615421		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25551557		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	25551557	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26615421	Associate	★☆☆☆☆ Found in Text Mining only