CTSS (cathepsin S)

Gene

• Entrez ID: 1520
• Gene name: Cathepsin S
• Gene symbol: CTSS
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The preproprotein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that participates in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The mature protein cleaves t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT704399	hsa-miR-8066	HITS-CLIP	23313552
MIRT704398	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT704397	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT704396	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT704395	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT704394	hsa-miR-4459	HITS-CLIP	23313552
MIRT704393	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT704392	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT704391	hsa-miR-544b	HITS-CLIP	23313552
MIRT704390	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT704389	hsa-miR-4794	HITS-CLIP	23313552
MIRT704388	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT704387	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT704386	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT704385	hsa-miR-3672	HITS-CLIP	23313552
MIRT704384	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT440859	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440857	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440859	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT727921	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727920	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT727919	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727918	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440857	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT733948	hsa-miR-4498	Luciferase reporter assay, qRT-PCR	33013913
MIRT736399	hsa-miR-369-3p	qRT-PCR, Flow cytometry	33679688
MIRT736410	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT704399	hsa-miR-8066	HITS-CLIP	23313552
MIRT704398	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT704397	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT704396	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT704395	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT704394	hsa-miR-4459	HITS-CLIP	23313552
MIRT704393	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT704392	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT704391	hsa-miR-544b	HITS-CLIP	23313552
MIRT704390	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT704389	hsa-miR-4794	HITS-CLIP	23313552
MIRT704388	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT704387	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT704386	hsa-miR-769-5p	HITS-CLIP	23313552
MIRT704385	hsa-miR-3672	HITS-CLIP	23313552
MIRT704384	hsa-miR-6864-3p	HITS-CLIP	23313552
MIRT916015	hsa-miR-1182	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT916017	hsa-miR-1299	CLIP-seq
MIRT916018	hsa-miR-193a-5p	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT916020	hsa-miR-3120-3p	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916022	hsa-miR-3182	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916027	hsa-miR-3664-5p	CLIP-seq
MIRT916028	hsa-miR-431	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916030	hsa-miR-4477a	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916032	hsa-miR-4659a-3p	CLIP-seq
MIRT916033	hsa-miR-4659b-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916035	hsa-miR-4782-5p	CLIP-seq
MIRT916036	hsa-miR-516b	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT916038	hsa-miR-1275	CLIP-seq
MIRT916039	hsa-miR-135a	CLIP-seq
MIRT916040	hsa-miR-135b	CLIP-seq
MIRT916041	hsa-miR-140-3p	CLIP-seq
MIRT916042	hsa-miR-185	CLIP-seq
MIRT916043	hsa-miR-203	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916045	hsa-miR-3150a-3p	CLIP-seq
MIRT916046	hsa-miR-3163	CLIP-seq
MIRT916047	hsa-miR-3175	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT916048	hsa-miR-329	CLIP-seq
MIRT916049	hsa-miR-340	CLIP-seq
MIRT916050	hsa-miR-342-5p	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916051	hsa-miR-362-3p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT916055	hsa-miR-4269	CLIP-seq
MIRT916056	hsa-miR-4275	CLIP-seq
MIRT916057	hsa-miR-4306	CLIP-seq
MIRT916058	hsa-miR-4314	CLIP-seq
MIRT916059	hsa-miR-4428	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916060	hsa-miR-4505	CLIP-seq
MIRT916061	hsa-miR-4514	CLIP-seq
MIRT916062	hsa-miR-4525	CLIP-seq
MIRT916063	hsa-miR-4644	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916064	hsa-miR-4651	CLIP-seq
MIRT916065	hsa-miR-4664-5p	CLIP-seq
MIRT916066	hsa-miR-4665-5p	CLIP-seq
MIRT916067	hsa-miR-4667-5p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916068	hsa-miR-4690-5p	CLIP-seq
MIRT916069	hsa-miR-4692	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT916071	hsa-miR-4700-5p	CLIP-seq
MIRT916072	hsa-miR-4723-5p	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT916074	hsa-miR-4731-5p	CLIP-seq
MIRT916075	hsa-miR-4738-3p	CLIP-seq
MIRT916076	hsa-miR-4773	CLIP-seq
MIRT916077	hsa-miR-483-3p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT916079	hsa-miR-548g	CLIP-seq
MIRT916080	hsa-miR-604	CLIP-seq
MIRT916081	hsa-miR-608	CLIP-seq
MIRT916082	hsa-miR-625	CLIP-seq
MIRT916083	hsa-miR-637	CLIP-seq
MIRT916084	hsa-miR-647	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT916085	hsa-miR-939	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT1971642	hsa-miR-1827	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT1971643	hsa-miR-3545-3p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT1971644	hsa-miR-3929	CLIP-seq
MIRT1971645	hsa-miR-4267	CLIP-seq
MIRT916056	hsa-miR-4275	CLIP-seq
MIRT1971646	hsa-miR-4419b	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT1971647	hsa-miR-4478	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT1971648	hsa-miR-4649-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT1971649	hsa-miR-4680-5p	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT1971650	hsa-miR-4722-5p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT1971651	hsa-miR-940	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916068	hsa-miR-4690-5p	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT2465143	hsa-miR-10a	CLIP-seq
MIRT2465144	hsa-miR-10b	CLIP-seq
MIRT2465145	hsa-miR-1268	CLIP-seq
MIRT2465146	hsa-miR-1268b	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT2465147	hsa-miR-339-5p	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT2465148	hsa-miR-4421	CLIP-seq
MIRT2465149	hsa-miR-4486	CLIP-seq
MIRT916060	hsa-miR-4505	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT2465150	hsa-miR-511	CLIP-seq
MIRT2465151	hsa-miR-548c-3p	CLIP-seq
MIRT2465152	hsa-miR-585	CLIP-seq
MIRT2510555	hsa-miR-103b	CLIP-seq
MIRT2510556	hsa-miR-106a	CLIP-seq
MIRT2510557	hsa-miR-106b	CLIP-seq
MIRT2465143	hsa-miR-10a	CLIP-seq
MIRT2465144	hsa-miR-10b	CLIP-seq
MIRT916015	hsa-miR-1182	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT2465145	hsa-miR-1268	CLIP-seq
MIRT2465146	hsa-miR-1268b	CLIP-seq
MIRT2510558	hsa-miR-1279	CLIP-seq
MIRT916017	hsa-miR-1299	CLIP-seq
MIRT2510559	hsa-miR-1323	CLIP-seq
MIRT2510560	hsa-miR-150	CLIP-seq
MIRT2510561	hsa-miR-17	CLIP-seq
MIRT916018	hsa-miR-193a-5p	CLIP-seq
MIRT2510562	hsa-miR-20a	CLIP-seq
MIRT2510563	hsa-miR-20b	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT2510564	hsa-miR-302a	CLIP-seq
MIRT2510565	hsa-miR-302b	CLIP-seq
MIRT2510566	hsa-miR-302c	CLIP-seq
MIRT2510567	hsa-miR-302d	CLIP-seq
MIRT2510568	hsa-miR-302e	CLIP-seq
MIRT916020	hsa-miR-3120-3p	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT2510569	hsa-miR-3148	CLIP-seq
MIRT916022	hsa-miR-3182	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT2465147	hsa-miR-339-5p	CLIP-seq
MIRT2510570	hsa-miR-3613-3p	CLIP-seq
MIRT2510571	hsa-miR-3617	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916027	hsa-miR-3664-5p	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT2510572	hsa-miR-371-5p	CLIP-seq
MIRT2510573	hsa-miR-371b-5p	CLIP-seq
MIRT2510574	hsa-miR-372	CLIP-seq
MIRT2510575	hsa-miR-373	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT2510576	hsa-miR-3940-5p	CLIP-seq
MIRT2510577	hsa-miR-3977	CLIP-seq
MIRT2510578	hsa-miR-423-3p	CLIP-seq
MIRT916028	hsa-miR-431	CLIP-seq
MIRT2465148	hsa-miR-4421	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT2510579	hsa-miR-4438	CLIP-seq
MIRT2465149	hsa-miR-4486	CLIP-seq
MIRT2510580	hsa-miR-4507	CLIP-seq
MIRT2510581	hsa-miR-4638-5p	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916032	hsa-miR-4659a-3p	CLIP-seq
MIRT916033	hsa-miR-4659b-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT2510582	hsa-miR-4714-3p	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT2510583	hsa-miR-4735-5p	CLIP-seq
MIRT2510584	hsa-miR-4775	CLIP-seq
MIRT916035	hsa-miR-4782-5p	CLIP-seq
MIRT2510585	hsa-miR-4797-5p	CLIP-seq
MIRT2510586	hsa-miR-494	CLIP-seq
MIRT2510587	hsa-miR-501-3p	CLIP-seq
MIRT2510588	hsa-miR-502-3p	CLIP-seq
MIRT2510589	hsa-miR-5095	CLIP-seq
MIRT2465150	hsa-miR-511	CLIP-seq
MIRT916036	hsa-miR-516b	CLIP-seq
MIRT2510590	hsa-miR-519d	CLIP-seq
MIRT2510591	hsa-miR-520a-3p	CLIP-seq
MIRT2510592	hsa-miR-520b	CLIP-seq
MIRT2510593	hsa-miR-520c-3p	CLIP-seq
MIRT2510594	hsa-miR-520d-3p	CLIP-seq
MIRT2510595	hsa-miR-520e	CLIP-seq
MIRT2510596	hsa-miR-520f	CLIP-seq
MIRT2510597	hsa-miR-526b	CLIP-seq
MIRT2510598	hsa-miR-548a-3p	CLIP-seq
MIRT2465151	hsa-miR-548c-3p	CLIP-seq
MIRT2510599	hsa-miR-548e	CLIP-seq
MIRT2510600	hsa-miR-548f	CLIP-seq
MIRT2510601	hsa-miR-548o	CLIP-seq
MIRT2510602	hsa-miR-562	CLIP-seq
MIRT2510603	hsa-miR-578	CLIP-seq
MIRT2465152	hsa-miR-585	CLIP-seq
MIRT2510604	hsa-miR-590-3p	CLIP-seq
MIRT2510605	hsa-miR-635	CLIP-seq
MIRT2510606	hsa-miR-641	CLIP-seq
MIRT2510607	hsa-miR-642b	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT2510608	hsa-miR-767-5p	CLIP-seq
MIRT2510609	hsa-miR-93	CLIP-seq
MIRT2510610	hsa-miR-944	CLIP-seq
MIRT2510555	hsa-miR-103b	CLIP-seq
MIRT2465143	hsa-miR-10a	CLIP-seq
MIRT2465144	hsa-miR-10b	CLIP-seq
MIRT916015	hsa-miR-1182	CLIP-seq
MIRT2678806	hsa-miR-1200	CLIP-seq
MIRT916016	hsa-miR-122	CLIP-seq
MIRT916017	hsa-miR-1299	CLIP-seq
MIRT2510559	hsa-miR-1323	CLIP-seq
MIRT916018	hsa-miR-193a-5p	CLIP-seq
MIRT916019	hsa-miR-214	CLIP-seq
MIRT916020	hsa-miR-3120-3p	CLIP-seq
MIRT916044	hsa-miR-3122	CLIP-seq
MIRT916021	hsa-miR-3135b	CLIP-seq
MIRT2510569	hsa-miR-3148	CLIP-seq
MIRT916022	hsa-miR-3182	CLIP-seq
MIRT916023	hsa-miR-3194-3p	CLIP-seq
MIRT2465147	hsa-miR-339-5p	CLIP-seq
MIRT2510570	hsa-miR-3613-3p	CLIP-seq
MIRT2510571	hsa-miR-3617	CLIP-seq
MIRT916024	hsa-miR-3619-5p	CLIP-seq
MIRT916025	hsa-miR-3650	CLIP-seq
MIRT916026	hsa-miR-3652	CLIP-seq
MIRT916027	hsa-miR-3664-5p	CLIP-seq
MIRT916052	hsa-miR-3689a-3p	CLIP-seq
MIRT916053	hsa-miR-3689c	CLIP-seq
MIRT2510572	hsa-miR-371-5p	CLIP-seq
MIRT2510573	hsa-miR-371b-5p	CLIP-seq
MIRT916054	hsa-miR-3913-5p	CLIP-seq
MIRT2510576	hsa-miR-3940-5p	CLIP-seq
MIRT916028	hsa-miR-431	CLIP-seq
MIRT2678807	hsa-miR-4324	CLIP-seq
MIRT2465148	hsa-miR-4421	CLIP-seq
MIRT916029	hsa-miR-4430	CLIP-seq
MIRT2510580	hsa-miR-4507	CLIP-seq
MIRT2678808	hsa-miR-450b-5p	CLIP-seq
MIRT916031	hsa-miR-4645-5p	CLIP-seq
MIRT916032	hsa-miR-4659a-3p	CLIP-seq
MIRT916033	hsa-miR-4659b-3p	CLIP-seq
MIRT916034	hsa-miR-4673	CLIP-seq
MIRT916070	hsa-miR-4695-3p	CLIP-seq
MIRT2510582	hsa-miR-4714-3p	CLIP-seq
MIRT916073	hsa-miR-4728-5p	CLIP-seq
MIRT916035	hsa-miR-4782-5p	CLIP-seq
MIRT2510585	hsa-miR-4797-5p	CLIP-seq
MIRT916078	hsa-miR-485-5p	CLIP-seq
MIRT2510586	hsa-miR-494	CLIP-seq
MIRT2465150	hsa-miR-511	CLIP-seq
MIRT916036	hsa-miR-516b	CLIP-seq
MIRT2678809	hsa-miR-518a-5p	CLIP-seq
MIRT2678810	hsa-miR-527	CLIP-seq
MIRT2510598	hsa-miR-548a-3p	CLIP-seq
MIRT2465151	hsa-miR-548c-3p	CLIP-seq
MIRT2510599	hsa-miR-548e	CLIP-seq
MIRT2510600	hsa-miR-548f	CLIP-seq
MIRT2510601	hsa-miR-548o	CLIP-seq
MIRT2510605	hsa-miR-635	CLIP-seq
MIRT2510606	hsa-miR-641	CLIP-seq
MIRT2510607	hsa-miR-642b	CLIP-seq
MIRT916037	hsa-miR-761	CLIP-seq
MIRT2510610	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Activation	16365419

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001968	Function	Fibronectin binding	IEA
GO:0001968	Function	Fibronectin binding	IPI	22952693
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IEP	15196205
GO:0002577	Process	Regulation of antigen processing and presentation	IDA	22365146
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	8612130, 12788072, 22952693
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	1373132
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	15752368, 22365146
GO:0005518	Function	Collagen binding	IDA	22952693
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9524075, 22952693
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	15196205
GO:0005764	Component	Lysosome	IEA
GO:0005770	Component	Late endosome	IDA	22365146
GO:0006508	Process	Proteolysis	IDA	12788072, 22864553
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	1373132
GO:0006955	Process	Immune response	TAS	8157683
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IDA	15752368, 22365146
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0010447	Process	Response to acidic pH	IDA	22864553
GO:0016485	Process	Protein processing	IDA	22864553
GO:0016787	Function	Hydrolase activity	IEA
GO:0019882	Process	Antigen processing and presentation	TAS	15196205
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	30612035
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0022617	Process	Extracellular matrix disassembly	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030574	Process	Collagen catabolic process	IDA	22952693
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28344315
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034769	Process	Basement membrane disassembly	IDA	22952693
GO:0036021	Component	Endolysosome lumen	IEA
GO:0036021	Component	Endolysosome lumen	TAS
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043236	Function	Laminin binding	IDA	22952693
GO:0043394	Function	Proteoglycan binding	IEA
GO:0043394	Function	Proteoglycan binding	IPI	22952693
GO:0045335	Component	Phagocytic vesicle	IDA	30612035
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0048002	Process	Antigen processing and presentation of peptide antigen	IDA	8612130
GO:0051603	Process	Proteolysis involved in protein catabolic process	IBA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IDA	22952693
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEP	21217776
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2001259	Process	Positive regulation of cation channel activity	IDA	22864553

Other IDs

• MIM: 116845
• HGNC: 2545
• e!Ensembl: ENSG00000163131

Protein

• UniProt ID: P25774
• Protein name: Cathepsin S (EC 3.4.22.27)
• Protein function: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules and MHC class II antigen presentation (PubMed:30612035). The bond-specificity of this proteinase is in part similar to the specificities
• PDB: 1GLO, 1MS6, 1NPZ, 1NQC, 2C0Y, 2F1G, 2FQ9, 2FRA, 2FRQ, 2FT2, 2FUD, 2FYE, 2G6D, 2G7Y, 2H7J, 2HH5, 2HHN, 2HXZ, 2OP3, 2R9M, 2R9N, 2R9O, 3IEJ, 3N3G, 3N4C, 3OVX, 4P6E, 4P6G, 5QBU, 5QBV, 5QBW, 5QBX, 5QBY, 5QBZ, 5QC0, 5QC1, 5QC2, 5QC3, 5QC4, 5QC5, 5QC6, 5QC7, 5QC8, 5QC9, 5QCA, 5QCB, 5QCC, 5QCD, 5QCE, 5QCF, 5QCG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08246	Inhibitor_I29	28 → 88	Cathepsin propeptide inhibitor domain (I29)	Domain
  PF00112	Peptidase_C1	115 → 330	Papain family cysteine protease	Domain

• Sequence:

  MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
  LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
  WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
  NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
  AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
  GHNFGEEGYIRMARNKGNHCGIASFPSYPEI

• Sequence length: 331

Pathways

KEGG:

Lysosome
Phagosome
Apoptosis
Antigen processing and presentation
Tuberculosis

Reactome:

Degradation of the extracellular matrix
Trafficking and processing of endosomal TLR
Assembly of collagen fibrils and other multimeric structures
MHC class II antigen presentation
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAROXYSMAL TACHYCARDIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	1837142, 39740768, 7575468, 7717452	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33892821, 39740768	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	18155003	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	25301844		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17322367, 22804761, 24833013	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25301844, 31156336		★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	29915952		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29915952		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10721671, 15985526, 21223957, 27595325, 29970364, 30549421, 31115520, 31156336, 31296090		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30248434, 31553637, 31729618		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	31553637	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	37069596	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11920402	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20855652, 27249607		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27249607, 40615557	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12819022, 19434518	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10721671, 15985526, 21223957, 27595325, 29970364, 30549421, 31115520, 31156336, 31296090		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32469254, 34925641	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28692065		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	25348778	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	31174203		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	31174203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	31174203		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28033540		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27796714, 29181829, 30185799, 30253340, 31346333		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27592448	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31461977	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28033540		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28793886		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31438640, 40256740	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18565099, 23747398, 28236030, 30848029, 31296090, 31729618		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18565099		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	27595325		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	37878141	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27344170	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30341237, 30848029		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28981104		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28981104		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19307473, 28240259		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18410260, 29976774, 30641028, 31553637		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	27344170		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30012612		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21896304		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21989182, 23443137, 29516317	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	19307473		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31844116		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20880494, 28978867, 30261474		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28978867, 30261474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	32469254	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	28978867, 30261474		★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	28449707		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23437289		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23437289	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	24940638	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	24940638, 30655278		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24940638	Stimulate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11920402		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	34208434	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30549421, 30581342		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31880859	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27858577, 30549421, 30581342		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36982499	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33062070	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37492198	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37773794	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	7717452	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30038391		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	36208723	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	10961902	Stimulate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	31358474		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	31358474	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19434518, 36552871	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24875536		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24875536		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19434518, 9153291	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	34819020	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27796714		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25496327, 31844116	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31844116		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	29365317	Associate	★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	31115520		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36982499	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33062070	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29615702, 31017016		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28793886		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36081453	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30012612		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35881699	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	19307473		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22796222, 24523067		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24940638, 30641028, 30655278, 31553637		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32476947	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28987592		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28987592		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29749483	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	32396854	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27796714, 29181829, 30006610, 30185799, 30253340, 31346333		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28793886		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28033540		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22101325, 23629809, 24875536, 27097645, 27796714, 27927016, 28282545, 29181829, 31115520, 31346333		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28981104		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18343923	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29047110		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23747398		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23747398, 30549421		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	15661938		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29611169	Stimulate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	12742663		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16365041, 18959458, 21896304, 22101325, 23629809, 27097645, 27796714, 28033540, 28282545, 28981104, 30006610, 31346333		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25883214	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	39740768	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24390241		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21595995, 28282545		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15985526, 18565099, 20164293, 22844403, 30549421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16034612	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	21156398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	22844403	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	11920402	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32176315	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	39740768	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29362520		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26334995	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28769800, 29362520		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	21228734		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	21228734		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	9066978	Associate	★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	28493068		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31605630		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31337649	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	34208434	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28289191, 31319889		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31017016		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17878156	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29976774, 31553637	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	15944319, 18410260		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	LHGDN	18410260		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31115520		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11920402		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	32476947	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	39364409	Stimulate	★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30038391, 30126300, 30423938, 31267034		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30423938	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33062070	Associate	★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	BEFREE	28623134		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29611169		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	24727728		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27058412	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35617240	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30038391, 30126300, 30423938, 31267034		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30038391, 30126300, 30423938, 31267034		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28493068		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	29365317	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29749483	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27796714, 30185799, 31346333		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15989693, 31748500	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19273215	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	31461977	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27595325		★☆☆☆☆ Found in Text Mining only