ADRA2C (adrenoceptor alpha 2C)

Gene

• Entrez ID: 152
• Gene name: Adrenoceptor alpha 2C
• Gene symbol: ADRA2C
• Synonyms (NCBI Gene): ADRA2L2, ADRA2RL2, ADRARL2, ALPHA2CAR
• Chromosome: 4
• Chromosome location: 4p16.3
• Summary: Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT769949	hsa-miR-1271	CLIP-seq
MIRT769950	hsa-miR-182	CLIP-seq
MIRT769951	hsa-miR-3150a-3p	CLIP-seq
MIRT769952	hsa-miR-3175	CLIP-seq
MIRT769953	hsa-miR-3936	CLIP-seq
MIRT769954	hsa-miR-4252	CLIP-seq
MIRT769955	hsa-miR-4271	CLIP-seq
MIRT769956	hsa-miR-4470	CLIP-seq
MIRT769957	hsa-miR-4489	CLIP-seq
MIRT769958	hsa-miR-4687-3p	CLIP-seq
MIRT769959	hsa-miR-4725-3p	CLIP-seq
MIRT769960	hsa-miR-4727-5p	CLIP-seq
MIRT769961	hsa-miR-4747-5p	CLIP-seq
MIRT769962	hsa-miR-4769-3p	CLIP-seq
MIRT769963	hsa-miR-483-5p	CLIP-seq
MIRT769964	hsa-miR-542-5p	CLIP-seq
MIRT769965	hsa-miR-625	CLIP-seq
MIRT769966	hsa-miR-647	CLIP-seq
MIRT769967	hsa-miR-939	CLIP-seq
MIRT769968	hsa-miR-96	CLIP-seq
MIRT1927080	hsa-miR-146b-3p	CLIP-seq
MIRT1927081	hsa-miR-1539	CLIP-seq
MIRT1927082	hsa-miR-1976	CLIP-seq
MIRT769951	hsa-miR-3150a-3p	CLIP-seq
MIRT1927083	hsa-miR-3173-5p	CLIP-seq
MIRT769952	hsa-miR-3175	CLIP-seq
MIRT1927084	hsa-miR-331-3p	CLIP-seq
MIRT1927085	hsa-miR-4536	CLIP-seq
MIRT1927086	hsa-miR-4722-3p	CLIP-seq
MIRT769963	hsa-miR-483-5p	CLIP-seq
MIRT1927087	hsa-miR-502-5p	CLIP-seq
MIRT769964	hsa-miR-542-5p	CLIP-seq
MIRT1927088	hsa-miR-874	CLIP-seq
MIRT769967	hsa-miR-939	CLIP-seq
MIRT2470524	hsa-miR-129-3p	CLIP-seq
MIRT2470525	hsa-miR-3690	CLIP-seq
MIRT2470526	hsa-miR-4254	CLIP-seq
MIRT2470527	hsa-miR-4434	CLIP-seq
MIRT2470528	hsa-miR-4516	CLIP-seq
MIRT2470529	hsa-miR-4531	CLIP-seq
MIRT2470530	hsa-miR-4690-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004938	Function	Alpha2-adrenergic receptor activity	EXP	10948191
GO:0004938	Function	Alpha2-adrenergic receptor activity	IBA
GO:0004938	Function	Alpha2-adrenergic receptor activity	IDA	17215105
GO:0004938	Function	Alpha2-adrenergic receptor activity	IEA
GO:0004938	Function	Alpha2-adrenergic receptor activity	IMP	10647009
GO:0004938	Function	Alpha2-adrenergic receptor activity	TAS	9371698
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	16531006, 32296183
GO:0005737	Component	Cytoplasm	IDA	16605244
GO:0005768	Component	Endosome	TAS	10196213
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16605244
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9371698
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	17215105
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17215105
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9371698
GO:0010700	Process	Negative regulation of norepinephrine secretion	IEA
GO:0010700	Process	Negative regulation of norepinephrine secretion	IMP	10647009
GO:0010700	Process	Negative regulation of norepinephrine secretion	NAS	16531006
GO:0010700	Process	Negative regulation of norepinephrine secretion	TAS	19477270
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0031694	Function	Alpha-2A adrenergic receptor binding	IPI	16605244
GO:0032811	Process	Negative regulation of epinephrine secretion	NAS	16531006
GO:0042803	Function	Protein homodimerization activity	IDA	16605244
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	17215105
GO:0045666	Process	Positive regulation of neuron differentiation	IDA	17215105
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0046676	Process	Negative regulation of insulin secretion	TAS
GO:0046982	Function	Protein heterodimerization activity	IPI	16605244
GO:0051379	Function	Epinephrine binding	IBA
GO:0051379	Function	Epinephrine binding	IDA	17215105
GO:0051379	Function	Epinephrine binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17215105
GO:0071875	Process	Adrenergic receptor signaling pathway	IDA	17215105

Other IDs

• MIM: 104250
• HGNC: 283
• e!Ensembl: ENSG00000184160

Protein

• UniProt ID: P18825
• Protein name: Alpha-2C adrenergic receptor (Alpha-2 adrenergic receptor subtype C4) (Alpha-2C adrenoreceptor) (Alpha-2C adrenoceptor) (Alpha-2CAR)
• Protein function: Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
• PDB: 6KUW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	68 → 437	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
  LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
  QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
  VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
  TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
  LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
  RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
  FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ

• Sequence length: 462

Pathways

KEGG:

cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Adrenoceptors
Adrenaline signalling through Alpha-2 adrenergic receptor
Adrenaline,noradrenaline inhibits insulin secretion
G alpha (i) signalling events
G alpha (z) signalling events
Surfactant metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADRA2C-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	16407544	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	24159564		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	11326305	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10334470, 11326305, 15108182, 18835330		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30383108		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	7719697		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	7719697		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	31218733		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31218733	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	18776959	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	18776959		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	20083574		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24308539	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	12374873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	14668769, 15542284, 17496726, 18320080, 18702968, 18947427, 19477404, 23207081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Constipation	Constipation	Pubtator	15138209	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	17324522	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	16407897		★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	BEFREE	15138209		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	15138209	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	12374873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	12374873, 15319474, 16188498, 18320080, 18776959, 18947427, 20128806	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	14668769, 17496726, 18320080, 18702968, 18947427, 19477404, 23207081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	12374873		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19742303	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16636200, 19742303, 24676565		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22560155		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	10334470		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	12374873		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	15319474	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	16407544	Inhibit	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	7719697		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16407897		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	LHGDN	16407897		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31218733		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16292538		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	16407897		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	16526032		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Failure	Myocardial Infarction	CTD_human_DG	12374873		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31218733		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	39793863	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11317218		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	24322971		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	36926933	Associate	★☆☆☆☆ Found in Text Mining only