LRRC34 (leucine rich repeat containing 34)

Gene

• Entrez ID: 151827
• Gene name: Leucine rich repeat containing 34
• Gene symbol: LRRC34
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q26.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT038798	hsa-miR-93-3p	CLASH	23622248
MIRT1119562	hsa-miR-374c	CLIP-seq
MIRT1119563	hsa-miR-3941	CLIP-seq
MIRT1119564	hsa-miR-4528	CLIP-seq
MIRT1119565	hsa-miR-4643	CLIP-seq
MIRT1119566	hsa-miR-466	CLIP-seq
MIRT1119567	hsa-miR-4672	CLIP-seq
MIRT1119568	hsa-miR-4789-3p	CLIP-seq
MIRT1119569	hsa-miR-655	CLIP-seq
MIRT1119570	hsa-miR-4735-5p	CLIP-seq
MIRT1119571	hsa-miR-622	CLIP-seq
MIRT1119572	hsa-miR-633	CLIP-seq
MIRT1550934	hsa-miR-1264	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	IEA
GO:0003674	Function	Molecular_function	ND
GO:0005575	Component	Cellular_component	ND
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0008150	Process	Biological_process	ND
GO:0010467	Process	Gene expression	IEA
GO:0030154	Process	Cell differentiation	IEA

Other IDs

• MIM: 619037
• HGNC: 28408
• e!Ensembl: ENSG00000171757

Protein

• UniProt ID: Q8IZ02
• Protein name: Leucine-rich repeat-containing protein 34
• Protein function: Highly expressed in stem cells where it may be involved in regulation of pluripotency. In embryonic stem cells (ESCs), important for normal expression of the pluripotency regulators POU5F1/OCT4 and KLF4. Also important for expression of the ecto
• PDB: 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13516	LRR_6	149 → 172	Leucine Rich repeat	Repeat
  PF13516	LRR_6	177 → 200	Leucine Rich repeat	Repeat
  PF13516	LRR_6	206 → 228	Leucine Rich repeat	Repeat
  PF13516	LRR_6	292 → 315	Leucine Rich repeat	Repeat
  PF13516	LRR_6	320 → 343	Leucine Rich repeat	Repeat
  PF13516	LRR_6	349 → 372	Leucine Rich repeat	Repeat

• Sequence:

  MAAQPPRPVGERSMGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNL
  CMEKSQKINPFILHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILK
  NCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRT
  LKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQNQAIKAI
  NLNRPILYSEQEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLD
  VSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVS
  NNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEATCIAYSDLIQMGCLKPDNTDVEPFVV
  DGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP

• Sequence length: 464

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL APLASIA OF THE VERMIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Joubert syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	31407831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ciliopathies	Ciliopathy	Pubtator	32055034	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	24349443	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24349443	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	33763035	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	26792595	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASDB_DG	23583980		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASCAT_DG	23583980		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	GWASDB_DG	23955597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	27363682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	31407831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	26792595	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	31407831		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26792595		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	GWASCAT_DG	28195142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasms	Thyroid cancer	Pubtator	28195142	Associate	★☆☆☆☆ Found in Text Mining only