SGO1 (shugoshin 1)

Gene

• Entrez ID: 151648
• Gene name: Shugoshin 1
• Gene symbol: SGO1
• Synonyms (NCBI Gene): CAID, NY-BR-85, SGO, SGOL1
• Chromosome: 3
• Chromosome location: 3p24.3
• Summary: The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this g

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT634348	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT634347	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT634346	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT634345	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT634344	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT634343	hsa-miR-215-3p	HITS-CLIP	23824327
MIRT634342	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT634341	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT634340	hsa-miR-3135b	HITS-CLIP	23824327
MIRT634339	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT634338	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT634337	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT634336	hsa-miR-3652	HITS-CLIP	23824327
MIRT634335	hsa-miR-4430	HITS-CLIP	23824327
MIRT634334	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT634333	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT634332	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT634331	hsa-miR-5698	HITS-CLIP	23824327
MIRT554353	hsa-miR-4422	PAR-CLIP	20371350
MIRT554351	hsa-miR-3168	PAR-CLIP	20371350
MIRT554352	hsa-miR-148b-5p	PAR-CLIP	20371350
MIRT554349	hsa-miR-6874-3p	PAR-CLIP	20371350
MIRT554350	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT554348	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT554347	hsa-miR-548ao-5p	PAR-CLIP	20371350
MIRT554346	hsa-miR-548ax	PAR-CLIP	20371350
MIRT554344	hsa-miR-5585-5p	PAR-CLIP	20371350
MIRT554345	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT554343	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT554342	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT554339	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT554338	hsa-miR-573	PAR-CLIP	20371350
MIRT554353	hsa-miR-4422	PAR-CLIP	21572407
MIRT554351	hsa-miR-3168	PAR-CLIP	21572407
MIRT554352	hsa-miR-148b-5p	PAR-CLIP	21572407
MIRT554349	hsa-miR-6874-3p	PAR-CLIP	21572407
MIRT554350	hsa-miR-5584-3p	PAR-CLIP	21572407
MIRT554348	hsa-miR-330-3p	PAR-CLIP	21572407
MIRT554347	hsa-miR-548ao-5p	PAR-CLIP	21572407
MIRT554346	hsa-miR-548ax	PAR-CLIP	21572407
MIRT554344	hsa-miR-5585-5p	PAR-CLIP	21572407
MIRT554345	hsa-miR-324-5p	PAR-CLIP	21572407
MIRT554343	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT554342	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT554341	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT554340	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT554339	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT554338	hsa-miR-573	PAR-CLIP	21572407
MIRT526704	hsa-miR-548av-3p	PAR-CLIP	22012620
MIRT526703	hsa-miR-548g-3p	PAR-CLIP	22012620
MIRT526702	hsa-miR-3129-3p	PAR-CLIP	22012620
MIRT526701	hsa-miR-5583-5p	PAR-CLIP	22012620
MIRT526700	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT526699	hsa-miR-4315	PAR-CLIP	22012620
MIRT526698	hsa-miR-4539	PAR-CLIP	22012620
MIRT526697	hsa-miR-4790-5p	PAR-CLIP	22012620
MIRT526696	hsa-miR-4799-5p	PAR-CLIP	22012620
MIRT526695	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT526694	hsa-miR-4263	PAR-CLIP	22012620
MIRT526693	hsa-miR-576-5p	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IDA	16682347, 24055156
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	16582621, 17621308
GO:0000776	Component	Kinetochore	IDA	17617734, 18331714, 24157919
GO:0000776	Component	Kinetochore	IEA
GO:0000779	Component	Condensed chromosome, centromeric region	IDA	19465021
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000922	Component	Spindle pole	IDA	18331714
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	16541025, 16580887, 17621308, 18331714, 18716626, 20562864, 20739936, 21346195, 21666598, 23242214, 24981860, 25173175, 27880917, 28330616, 29263825, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	18331714, 24157919
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007059	Process	Chromosome segregation	IDA	16580887
GO:0007059	Process	Chromosome segregation	IEA
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	IDA	17621308
GO:0010457	Process	Centriole-centriole cohesion	IDA	18331714
GO:0010457	Process	Centriole-centriole cohesion	IEA
GO:0010457	Process	Centriole-centriole cohesion	IEA
GO:0010457	Process	Centriole-centriole cohesion	IMP	18331714
GO:0016607	Component	Nuclear speck	IDA	31429579
GO:0016607	Component	Nuclear speck	IEA
GO:0019900	Function	Kinase binding	IDA	18331714
GO:0045132	Process	Meiotic chromosome segregation	IEA
GO:0045132	Process	Meiotic chromosome segregation	IMP	18331714
GO:0051301	Process	Cell division	IEA
GO:0071962	Process	Mitotic sister chromatid cohesion, centromeric	IMP	24157919

Other IDs

• MIM: 609168
• HGNC: 25088
• e!Ensembl: ENSG00000129810

Protein

• UniProt ID: Q5FBB7
• Protein name: Shugoshin 1 (Serologically defined breast cancer antigen NY-BR-85) (Shugoshin-like 1)
• Protein function: Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphoryla
• PDB: 3FGA, 3Q6S, 4A0I, 7ZJS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07558	Shugoshin_N	22 → 66	Shugoshin N-terminal coiled-coil region	Coiled-coil
  PF07557	Shugoshin_C	474 → 496	Shugoshin C terminus	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested. {ECO:0000269|PubMed:12747765}.
• Sequence:

  MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDN
  NKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSS
  GMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKS
  TDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPEN
  VQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
  RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREE
  NNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS
  KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTA
  SVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVR
  EFVSRFPDCRKCKLETHICLR

• Sequence length: 561

Pathways

KEGG:

Cell cycle
Oocyte meiosis

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cardiovascular phenotype	Pathogenic	rs199815268	RCV005404271	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic atrial and intestinal dysrhythmia	Pathogenic	rs199815268	RCV000150047	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SGO1-related disorder	Pathogenic	rs199815268	RCV004758652	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARRHYTHMIAS, CARDIAC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ATRIAL AND INTESTINAL DYSRHYTHMIA SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONOBIOLOGY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32923148	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	30231670		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	29943428		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	29943428, 30231670		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	25736928, 35044816	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	30739867	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22161216, 23564482, 38077434	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25638162	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22161216		★☆☆☆☆ Found in Text Mining only
Chronic atrial and intestinal dysrhythmia	Atrial And Intestinal Dysrhythmia	BEFREE	25282101, 25352100		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic atrial and intestinal dysrhythmia	Atrial And Intestinal Dysrhythmia	GENOMICS_ENGLAND_DG	25282101		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic atrial and intestinal dysrhythmia	Atrial And Intestinal Dysrhythmia	ORPHANET_DG	25282101		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic atrial and intestinal dysrhythmia	Atrial And Intestinal Dysrhythmia	UNIPROT_DG	25282101		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic atrial and intestinal dysrhythmia	Atrial And Intestinal Dysrhythmia	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic atrial and intestinal dysrhythmia	Atrial And Intestinal Dysrhythmia	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic atrial and intestinal dysrhythmia syndrome	Atrial And Intestinal Dysrhythmia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronobiology Disorders	Chronobiology Disorders	CTD_human_DG	25282101		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Circadian Rhythm Disorders	Circadian Rhythm Disorders	CTD_human_DG	25282101		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21532624, 25773652		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25773652		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18635744, 21532624, 23850494		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18635744		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28734496		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23102702		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	CTD_human_DG	25282101		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23102702		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25638162, 25740822, 29467456		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25638162		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22161216	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28734496		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22161216, 24146025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30799941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23564482		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21532624, 22161216		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21532624, 25773652		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18635744, 23850494, 25773652		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22161216, 24146025		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30799941		★☆☆☆☆ Found in Text Mining only
Psychogenic Inversion of Circadian Rhythm	Circadian Rhythm Disorders	CTD_human_DG	25282101		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23564482		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23564482	Associate	★☆☆☆☆ Found in Text Mining only