Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	151531
Gene name	Uridine phosphorylase 2
Gene symbol	UPP2
Synonyms (NCBI Gene)	UDRPASE2UP2UPASE2
Chromosome	2
Chromosome location	2q24.1

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052364	hsa-let-7a-5p	CLASH	23622248
MIRT539579	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT539578	hsa-miR-26a-1-3p	PAR-CLIP	21572407
MIRT539577	hsa-miR-26a-2-3p	PAR-CLIP	21572407
MIRT539576	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT539575	hsa-miR-134-3p	PAR-CLIP	21572407
MIRT539579	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT539578	hsa-miR-26a-1-3p	PAR-CLIP	21572407
MIRT539577	hsa-miR-26a-2-3p	PAR-CLIP	21572407
MIRT539576	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT539575	hsa-miR-134-3p	PAR-CLIP	21572407
MIRT539579	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT539578	hsa-miR-26a-1-3p	PAR-CLIP	21572407
MIRT539577	hsa-miR-26a-2-3p	PAR-CLIP	21572407
MIRT539576	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT539575	hsa-miR-134-3p	PAR-CLIP	21572407
MIRT539579	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT539578	hsa-miR-26a-1-3p	PAR-CLIP	21572407
MIRT539577	hsa-miR-26a-2-3p	PAR-CLIP	21572407
MIRT539576	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT539575	hsa-miR-134-3p	PAR-CLIP	21572407
MIRT1476432	hsa-miR-155	CLIP-seq
MIRT1476433	hsa-miR-515-3p	CLIP-seq
MIRT1476434	hsa-miR-519e	CLIP-seq
MIRT1476435	hsa-miR-550a	CLIP-seq
MIRT1476436	hsa-miR-136	CLIP-seq
MIRT1476437	hsa-miR-1913	CLIP-seq
MIRT1476438	hsa-miR-3074-5p	CLIP-seq
MIRT1476439	hsa-miR-3189-5p	CLIP-seq
MIRT1476440	hsa-miR-324-3p	CLIP-seq
MIRT1476441	hsa-miR-4722-3p	CLIP-seq
MIRT1476442	hsa-miR-4758-3p	CLIP-seq
MIRT1476433	hsa-miR-515-3p	CLIP-seq
MIRT1476434	hsa-miR-519e	CLIP-seq
MIRT1476435	hsa-miR-550a	CLIP-seq
MIRT1476433	hsa-miR-515-3p	CLIP-seq
MIRT1476434	hsa-miR-519e	CLIP-seq
MIRT1476435	hsa-miR-550a	CLIP-seq
MIRT2143536	hsa-miR-3163	CLIP-seq
MIRT2143537	hsa-miR-4517	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004850	Function	Uridine phosphorylase activity	IBA
GO:0004850	Function	Uridine phosphorylase activity	IDA	12849978, 21855639
GO:0004850	Function	Uridine phosphorylase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 26871637, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	NAS	11278417
GO:0005829	Component	Cytosol	TAS
GO:0006218	Process	Uridine catabolic process	IBA
GO:0006218	Process	Uridine catabolic process	IDA	12849978, 21855639
GO:0006218	Process	Uridine catabolic process	IEA
GO:0006248	Process	CMP catabolic process	IEA
GO:0006249	Process	DCMP catabolic process	IDA	12849978
GO:0009116	Process	Nucleoside metabolic process	IEA
GO:0009116	Process	Nucleoside metabolic process	NAS	12849978
GO:0009166	Process	Nucleotide catabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016763	Function	Pentosyltransferase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	21855639, 25416956, 26871637, 29892012, 31515488, 32296183
GO:0044206	Process	UMP salvage	IEA
GO:0045098	Component	Type III intermediate filament	IDA	11278417
GO:0046050	Process	UMP catabolic process	IEA
GO:0046108	Process	Uridine metabolic process	NAS	11278417
GO:0047847	Function	Deoxyuridine phosphorylase activity	IDA	12849978
GO:0047847	Function	Deoxyuridine phosphorylase activity	IEA

MIM	HGNC	e!Ensembl
617340	23061	ENSG00000007001

O95045

Protein name

Uridine phosphorylase 2 (UPase 2) (UrdPase 2) (EC 2.4.2.3)

Protein function

Catalyzes the reversible phosphorylytic cleavage of uridine to uracil and ribose-1-phosphate which can then be utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis (PubMed:12849978, PubMed:21855639)

PDB

2XRF , 3P0E , 3P0F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01048	PNP_UDP_1	60 → 310	Phosphorylase superfamily	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in kidney. {ECO:0000269|PubMed:12849978}.

Sequence

MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVK
FVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPS
ISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDN
IVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLD
YLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQR
PQLLISNFIRRRLGLCD

Sequence length

317

Interactions

View interactions

	KEGG		Reactome
	Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism		Pyrimidine salvage Pyrimidine catabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL LEFT-SIDED HEART LESIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	21151189		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26781567		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	21151189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29021814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29021814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28448891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	25897834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10955799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	31842742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10955799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	9515818		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	10404304, 9515818		★★★★★ ★☆☆☆☆ Found in Text Mining only

UPP2 (uridine phosphorylase 2)