Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	151258
Gene name	Solute carrier family 38 member 11
Gene symbol	SLC38A11
Synonyms (NCBI Gene)	AVT2
Chromosome	2
Chromosome location	2q24.3

Show/Hide all (9)

miRTarBase ID	miRNA	Experiments
MIRT1362268	hsa-miR-25	CLIP-seq
MIRT1362269	hsa-miR-32	CLIP-seq
MIRT1362270	hsa-miR-363	CLIP-seq
MIRT1362271	hsa-miR-367	CLIP-seq
MIRT1362272	hsa-miR-3691-3p	CLIP-seq
MIRT1362273	hsa-miR-4325	CLIP-seq
MIRT1362274	hsa-miR-4480	CLIP-seq
MIRT1362275	hsa-miR-92a	CLIP-seq
MIRT1362276	hsa-miR-92b	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003333	Process	Amino acid transmembrane transport	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006865	Process	Amino acid transport	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IBA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IEA

MIM	HGNC	e!Ensembl
616526	26836	ENSG00000169507

Q08AI6

Protein name

Putative sodium-coupled neutral amino acid transporter 11 (Solute carrier family 38 member 11)

Protein function

Putative sodium-dependent amino acid/proton antiporter.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01490	Aa_trans	1 → 364	Transmembrane amino acid transporter protein	Family

Sequence

MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIAMISYNIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAK
LGKVSLISTGLTTLILGIVMARAISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHN
SFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDL
VTFGRFCYGVTVILTYPMECFVTREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLLID
CLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMA
ITNTQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSTLNISIFQ

Sequence length

406

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37967238	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SLC38A11 (solute carrier family 38 member 11)