CTSH (cathepsin H)

Gene

• Entrez ID: 1512
• Gene name: Cathepsin H
• Gene symbol: CTSH
• Synonyms (NCBI Gene): ACC-4, ACC-5, ACC4, ACC5, CPSB
• Chromosome: 15
• Chromosome location: 15q25.1
• Summary: The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encode

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022220	hsa-miR-124-3p	Microarray	18668037
MIRT915920	hsa-miR-1178	CLIP-seq
MIRT915921	hsa-miR-1285	CLIP-seq
MIRT915922	hsa-miR-2114	CLIP-seq
MIRT915923	hsa-miR-299-3p	CLIP-seq
MIRT915924	hsa-miR-3150a-3p	CLIP-seq
MIRT915925	hsa-miR-3175	CLIP-seq
MIRT915926	hsa-miR-3180-5p	CLIP-seq
MIRT915927	hsa-miR-3187-5p	CLIP-seq
MIRT915928	hsa-miR-3190	CLIP-seq
MIRT915929	hsa-miR-3689d	CLIP-seq
MIRT915930	hsa-miR-3907	CLIP-seq
MIRT915931	hsa-miR-3978	CLIP-seq
MIRT915932	hsa-miR-4254	CLIP-seq
MIRT915933	hsa-miR-4292	CLIP-seq
MIRT915934	hsa-miR-4308	CLIP-seq
MIRT915935	hsa-miR-4464	CLIP-seq
MIRT915936	hsa-miR-4491	CLIP-seq
MIRT915937	hsa-miR-4505	CLIP-seq
MIRT915938	hsa-miR-4633-3p	CLIP-seq
MIRT915939	hsa-miR-4645-5p	CLIP-seq
MIRT915940	hsa-miR-4657	CLIP-seq
MIRT915941	hsa-miR-4667-5p	CLIP-seq
MIRT915942	hsa-miR-4673	CLIP-seq
MIRT915943	hsa-miR-4700-5p	CLIP-seq
MIRT915944	hsa-miR-4748	CLIP-seq
MIRT915945	hsa-miR-612	CLIP-seq
MIRT915946	hsa-miR-637	CLIP-seq
MIRT915947	hsa-miR-939	CLIP-seq
MIRT915937	hsa-miR-4505	CLIP-seq
MIRT915921	hsa-miR-1285	CLIP-seq
MIRT915926	hsa-miR-3180-5p	CLIP-seq
MIRT915927	hsa-miR-3187-5p	CLIP-seq
MIRT2207340	hsa-miR-4257	CLIP-seq
MIRT915937	hsa-miR-4505	CLIP-seq
MIRT915939	hsa-miR-4645-5p	CLIP-seq
MIRT915942	hsa-miR-4673	CLIP-seq
MIRT915945	hsa-miR-612	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001520	Component	Outer dense fiber	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001656	Process	Metanephros development	ISS
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0001913	Process	T cell mediated cytotoxicity	ISS
GO:0002250	Process	Adaptive immune response	IEP	15196205
GO:0002764	Process	Immune response-regulating signaling pathway	IDA	16822283
GO:0004175	Function	Endopeptidase activity	IDA	14766755, 15127951
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	IDA	15127951
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	6203523
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	2849458
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	ISS
GO:0005515	Function	Protein binding	IPI	6203523, 15127951, 22365146, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9050938, 18216060, 21217776
GO:0005615	Component	Extracellular space	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	1837142, 15196205, 16822283
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	IDA	9050938
GO:0005930	Component	Axoneme	IEA
GO:0006508	Process	Proteolysis	IDA	6203523, 8811434
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2849458
GO:0006915	Process	Apoptotic process	IEA
GO:0006955	Process	Immune response	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008233	Function	Peptidase activity	IDA	18216060
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IDA	8811434, 22365146
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	TAS	2587265
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IBA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	20435891
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	21217776
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	ISS
GO:0010813	Process	Neuropeptide catabolic process	IDA	15127951
GO:0010815	Process	Bradykinin catabolic process	IDA	15127951
GO:0016505	Function	Peptidase activator activity involved in apoptotic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019882	Process	Antigen processing and presentation	TAS	15196205
GO:0030108	Function	HLA-A specific activating MHC class I receptor activity	IDA	16822283
GO:0030335	Process	Positive regulation of cell migration	IDA	21217776
GO:0030984	Function	Kininogen binding	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0031638	Process	Zymogen activation	IDA	20435891
GO:0031638	Process	Zymogen activation	IEA
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	IMP	17500053
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032526	Process	Response to retinoic acid	ISS
GO:0033619	Process	Membrane protein proteolysis	IDA	14766755
GO:0033619	Process	Membrane protein proteolysis	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0042802	Function	Identical protein binding	IEA
GO:0043129	Process	Surfactant homeostasis	IDA	18216060
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IBA
GO:0060448	Process	Dichotomous subdivision of terminal units involved in lung branching	IEA
GO:0060448	Process	Dichotomous subdivision of terminal units involved in lung branching	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070324	Function	Thyroid hormone binding	IDA	21217776
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	21217776
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEA
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEP	21217776
GO:0097208	Component	Alveolar lamellar body	IDA	18216060
GO:0097208	Component	Alveolar lamellar body	IEA
GO:0097486	Component	Multivesicular body lumen	TAS
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905146	Process	Lysosomal protein catabolic process	IDA	15752368
GO:1990834	Process	Response to odorant	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IBA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 116820
• HGNC: 2535
• e!Ensembl: ENSG00000103811

Protein

• UniProt ID: P09668
• Protein name: Pro-cathepsin H [Cleaved into: Cathepsin H mini chain; Cathepsin H (EC 3.4.22.16); Cathepsin H heavy chain; Cathepsin H light chain]
• Protein function: Important for the overall degradation of proteins in lysosomes.
• PDB: 6CZK, 6CZS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08246	Inhibitor_I29	35 → 90	Cathepsin propeptide inhibitor domain (I29)	Domain
  PF00112	Peptidase_C1	116 → 332	Papain family cysteine protease	Domain

• Sequence:

  MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFAS
  NWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSV
  DWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHG
  CQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMV
  EAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVK
  NSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV

• Sequence length: 335

Pathways

KEGG:

Lysosome
Apoptosis

Reactome:

MHC class II antigen presentation
Surfactant metabolism
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CTSH-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY TYPE 1	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32413284, 34937778, 37925455, 38527854	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	39740768	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amnesia, Transient Global	Amnesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32792518	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	18155003	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11436088	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	11436088		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	32724101	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	31174203		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	31174203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	31174203		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	21771265	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	18978792		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36982347	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	39312365	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36982347	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10732746	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34716619	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39312365	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	14767779, 27442865		★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	12792315		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	10755408	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10755408	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15646835		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	27913303		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21270831, 22825589, 25743184, 31558544, 33992646	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22825589	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	18978792, 19430480, 25751624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	18978792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	18978792, 19430480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22825589, 24982147, 25743184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	18978792		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22825589		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	18978792		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	18978792		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26245339		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	27913303		★☆☆☆☆ Found in Text Mining only
Esophageal atresia with or without tracheoesophageal fistula	Tracheoesophageal fistula	BEFREE	29732364		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32792518	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24657443	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	16822283	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	16822283		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	24982147		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	38527854	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21217776		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21217776		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	23483898		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23483898	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10732746, 37471639	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15645424		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37679517	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	8641471		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14662023		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18949742		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	39312365	Inhibit	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	12468644		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29470604		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	BEFREE	23830514		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	ORPHANET_DG	23459209		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASCAT_DG	23459209		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	23497937, 23725858, 25743184		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	25743184	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	ORPHANET_DG	23459209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	15645424, 27442865, 8641471		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	8641471		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	8641471	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	26245339		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	9066978	Associate	★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	26245339		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11796715		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	11796715	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	18216060	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	40226625	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	39312365	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27442865		★☆☆☆☆ Found in Text Mining only