ZNF385B (zinc finger protein 385B)

Gene

• Entrez ID: 151126
• Gene name: Zinc finger protein 385B
• Gene symbol: ZNF385B
• Synonyms (NCBI Gene): ZNF533
• Chromosome: 2
• Chromosome location: 2q31.2-q31.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024722	hsa-miR-215-5p	Microarray	19074876
MIRT026853	hsa-miR-192-5p	Microarray	19074876
MIRT1523592	hsa-miR-1278	CLIP-seq
MIRT1523593	hsa-miR-3120-3p	CLIP-seq
MIRT1523594	hsa-miR-325	CLIP-seq
MIRT1523595	hsa-miR-4672	CLIP-seq
MIRT1523596	hsa-miR-628-3p	CLIP-seq
MIRT1523597	hsa-miR-1283	CLIP-seq
MIRT1523598	hsa-miR-3678-3p	CLIP-seq
MIRT1523599	hsa-miR-3915	CLIP-seq
MIRT1523600	hsa-miR-3928	CLIP-seq
MIRT1523601	hsa-miR-5095	CLIP-seq
MIRT1523602	hsa-miR-552	CLIP-seq
MIRT2397532	hsa-miR-1275	CLIP-seq
MIRT2397533	hsa-miR-4525	CLIP-seq
MIRT2397534	hsa-miR-4665-5p	CLIP-seq
MIRT2397535	hsa-miR-4723-5p	CLIP-seq
MIRT2397536	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002039	Function	P53 binding	IPI	22945289
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22945289
GO:0005634	Component	Nucleus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IDA	22945289

Other IDs

• MIM: 612344
• HGNC: 26332
• e!Ensembl: ENSG00000144331

Protein

• UniProt ID: Q569K4
• Protein name: Zinc finger protein 385B (Zinc finger protein 533)
• Protein function: May play a role in p53/TP53-mediated apoptosis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12874	zf-met	34 → 58		Domain
  PF12874	zf-met	157 → 181		Domain
  PF12874	zf-met	285 → 309		Domain
  PF12874	zf-met	348 → 372		Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in germinal center of lymph node (at protein level). Expressed in spleen, lymph node and tonsil. {ECO:0000269|PubMed:22945289}.
• Sequence:

  MNMANFLRGFEEKGIKNDRPEDQLSKEKKKILFSFCEVCNIQLNSAAQAQVHSNGKSHRK
  RVKQLSDGQPPPPAQASPSSNSSTGSTCHTTTLPALVRTPTLMMQPSLDIKPFMSFPVDS
  SSAVGLFPNFNTMDPVQKAVINHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSK
  HAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQPSSS
  ESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEKAKKLLYCSLCKVAVNSLSQL
  EAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHCEICDVHVNSE
  IQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQKDMMKPLAPAFLSSP
  LAAAAAVSSALSLPPRPSASLFQAPAIPPALLRPGHGPIRATPASILFAPY

• Sequence length: 471

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE REPRODUCTIVE ORGAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autistic Disorder	Autism	BEFREE	24599690		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24599690	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28145423	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22945289	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28145423		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21658281		★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	CHARGE Syndrome	BEFREE	18413373		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	18413373		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23029477, 28145423		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	18413373		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31576015		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23253381		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28145423		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23029477	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndactyly	Syndactyly	BEFREE	28600059		★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	Pubtator	28600059	Associate	★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16953426		★☆☆☆☆ Found in Text Mining only