ADRA2B (adrenoceptor alpha 2B)

Gene

• Entrez ID: 151
• Gene name: Adrenoceptor alpha 2B
• Gene symbol: ADRA2B
• Synonyms (NCBI Gene): ADRA2L1, ADRA2RL1, ADRARL1, ALPHA2BAR, FAME2, alpha-2BAR
• Chromosome: 2
• Chromosome location: 2q11.2
• Summary: This intronless gene encodes a seven-pass transmembrane protein. This protein is a member of a subfamily of G protein-coupled receptors that regulate neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous syste

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs786205528	G>A	Likely-pathogenic	Coding sequence variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT713041	hsa-miR-1245a	HITS-CLIP	19536157
MIRT713040	hsa-miR-8079	HITS-CLIP	19536157
MIRT713039	hsa-miR-1247-5p	HITS-CLIP	19536157
MIRT713038	hsa-miR-6777-5p	HITS-CLIP	19536157
MIRT713037	hsa-miR-6889-5p	HITS-CLIP	19536157
MIRT713036	hsa-miR-542-5p	HITS-CLIP	19536157
MIRT713041	hsa-miR-1245a	HITS-CLIP	19536157
MIRT713040	hsa-miR-8079	HITS-CLIP	19536157
MIRT713039	hsa-miR-1247-5p	HITS-CLIP	19536157
MIRT713038	hsa-miR-6777-5p	HITS-CLIP	19536157
MIRT713037	hsa-miR-6889-5p	HITS-CLIP	19536157
MIRT713036	hsa-miR-542-5p	HITS-CLIP	19536157
MIRT616471	hsa-miR-15a-5p	HITS-CLIP	23824327
MIRT616470	hsa-miR-15b-5p	HITS-CLIP	23824327
MIRT616469	hsa-miR-16-5p	HITS-CLIP	23824327
MIRT616468	hsa-miR-195-5p	HITS-CLIP	23824327
MIRT616467	hsa-miR-424-5p	HITS-CLIP	23824327
MIRT616466	hsa-miR-497-5p	HITS-CLIP	23824327
MIRT616465	hsa-miR-6838-5p	HITS-CLIP	23824327
MIRT616464	hsa-miR-922	HITS-CLIP	23824327
MIRT616463	hsa-miR-214-3p	HITS-CLIP	23824327
MIRT616462	hsa-miR-3619-5p	HITS-CLIP	23824327
MIRT616461	hsa-miR-761	HITS-CLIP	23824327
MIRT616460	hsa-miR-4291	HITS-CLIP	23824327
MIRT616459	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT616458	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT616457	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT616456	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT616455	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT616454	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT527167	hsa-miR-4286	PAR-CLIP	22012620
MIRT527166	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT527165	hsa-miR-4667-5p	PAR-CLIP	22012620
MIRT527163	hsa-miR-4700-5p	PAR-CLIP	22012620
MIRT527164	hsa-miR-8089	PAR-CLIP	22012620
MIRT527162	hsa-miR-3175	PAR-CLIP	22012620
MIRT527161	hsa-miR-1343-5p	PAR-CLIP	22012620
MIRT527160	hsa-miR-939-5p	PAR-CLIP	22012620
MIRT527159	hsa-miR-6825-5p	PAR-CLIP	22012620
MIRT527158	hsa-miR-3150a-3p	PAR-CLIP	22012620
MIRT527157	hsa-miR-6763-5p	PAR-CLIP	22012620
MIRT713041	hsa-miR-1245a	HITS-CLIP	19536157
MIRT713040	hsa-miR-8079	HITS-CLIP	19536157
MIRT713039	hsa-miR-1247-5p	HITS-CLIP	19536157
MIRT713038	hsa-miR-6777-5p	HITS-CLIP	19536157
MIRT713037	hsa-miR-6889-5p	HITS-CLIP	19536157
MIRT713036	hsa-miR-542-5p	HITS-CLIP	19536157
MIRT713041	hsa-miR-1245a	HITS-CLIP	19536157
MIRT713040	hsa-miR-8079	HITS-CLIP	19536157
MIRT713039	hsa-miR-1247-5p	HITS-CLIP	19536157
MIRT713038	hsa-miR-6777-5p	HITS-CLIP	19536157
MIRT713037	hsa-miR-6889-5p	HITS-CLIP	19536157
MIRT713036	hsa-miR-542-5p	HITS-CLIP	19536157
MIRT616471	hsa-miR-15a-5p	HITS-CLIP	23824327
MIRT616470	hsa-miR-15b-5p	HITS-CLIP	23824327
MIRT616469	hsa-miR-16-5p	HITS-CLIP	23824327
MIRT616468	hsa-miR-195-5p	HITS-CLIP	23824327
MIRT616467	hsa-miR-424-5p	HITS-CLIP	23824327
MIRT616466	hsa-miR-497-5p	HITS-CLIP	23824327
MIRT616465	hsa-miR-6838-5p	HITS-CLIP	23824327
MIRT616464	hsa-miR-922	HITS-CLIP	23824327
MIRT616463	hsa-miR-214-3p	HITS-CLIP	23824327
MIRT616462	hsa-miR-3619-5p	HITS-CLIP	23824327
MIRT616461	hsa-miR-761	HITS-CLIP	23824327
MIRT616460	hsa-miR-4291	HITS-CLIP	23824327
MIRT616459	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT616458	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT616457	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT616456	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT616455	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT616454	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT527167	hsa-miR-4286	PAR-CLIP	22012620
MIRT527166	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT527165	hsa-miR-4667-5p	PAR-CLIP	22012620
MIRT527163	hsa-miR-4700-5p	PAR-CLIP	22012620
MIRT527164	hsa-miR-8089	PAR-CLIP	22012620
MIRT527162	hsa-miR-3175	PAR-CLIP	22012620
MIRT527161	hsa-miR-1343-5p	PAR-CLIP	22012620
MIRT527160	hsa-miR-939-5p	PAR-CLIP	22012620
MIRT527159	hsa-miR-6825-5p	PAR-CLIP	22012620
MIRT527158	hsa-miR-3150a-3p	PAR-CLIP	22012620
MIRT527157	hsa-miR-6763-5p	PAR-CLIP	22012620
MIRT769947	hsa-miR-31	CLIP-seq
MIRT769948	hsa-miR-4707-5p	CLIP-seq
MIRT1921514	hsa-miR-15a	CLIP-seq
MIRT1921515	hsa-miR-15b	CLIP-seq
MIRT1921516	hsa-miR-16	CLIP-seq
MIRT1921517	hsa-miR-195	CLIP-seq
MIRT1921518	hsa-miR-214	CLIP-seq
MIRT1921519	hsa-miR-424	CLIP-seq
MIRT1921520	hsa-miR-497	CLIP-seq
MIRT1921514	hsa-miR-15a	CLIP-seq
MIRT1921515	hsa-miR-15b	CLIP-seq
MIRT1921516	hsa-miR-16	CLIP-seq
MIRT1921517	hsa-miR-195	CLIP-seq
MIRT1921518	hsa-miR-214	CLIP-seq
MIRT1921519	hsa-miR-424	CLIP-seq
MIRT1921520	hsa-miR-497	CLIP-seq
MIRT2168008	hsa-miR-140-3p	CLIP-seq
MIRT2168009	hsa-miR-149	CLIP-seq
MIRT2168010	hsa-miR-3064-5p	CLIP-seq
MIRT2168011	hsa-miR-3119	CLIP-seq
MIRT2168012	hsa-miR-3914	CLIP-seq
MIRT2168013	hsa-miR-3936	CLIP-seq
MIRT2168014	hsa-miR-4426	CLIP-seq
MIRT2168015	hsa-miR-4454	CLIP-seq
MIRT2168016	hsa-miR-4647	CLIP-seq
MIRT2168017	hsa-miR-4662b	CLIP-seq
MIRT2168018	hsa-miR-4700-3p	CLIP-seq
MIRT2168019	hsa-miR-4794	CLIP-seq
MIRT2168020	hsa-miR-607	CLIP-seq
MIRT2470521	hsa-miR-1976	CLIP-seq
MIRT2470522	hsa-miR-3136-3p	CLIP-seq
MIRT2470523	hsa-miR-4267	CLIP-seq
MIRT2470521	hsa-miR-1976	CLIP-seq
MIRT2674636	hsa-miR-23a	CLIP-seq
MIRT2674637	hsa-miR-23b	CLIP-seq
MIRT2674638	hsa-miR-23c	CLIP-seq
MIRT2674639	hsa-miR-3074-3p	CLIP-seq
MIRT2470522	hsa-miR-3136-3p	CLIP-seq
MIRT2674640	hsa-miR-34b	CLIP-seq
MIRT2470523	hsa-miR-4267	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Activation	15037199
STAT6	Unknown	15037199
TFAP2A	Unknown	15037199

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003056	Process	Regulation of vascular associated smooth muscle contraction	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004938	Function	Alpha2-adrenergic receptor activity	IBA
GO:0004938	Function	Alpha2-adrenergic receptor activity	IDA	17215105
GO:0004938	Function	Alpha2-adrenergic receptor activity	IEA
GO:0004938	Function	Alpha2-adrenergic receptor activity	TAS	2164221
GO:0005515	Function	Protein binding	IPI	16531006, 23105096, 24114805, 26811329, 27901063
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	29069590
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2164221
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	17215105
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17215105
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	2164221
GO:0007565	Process	Female pregnancy	IEA
GO:0009986	Component	Cell surface	IDA	27901063
GO:0010700	Process	Negative regulation of norepinephrine secretion	IEA
GO:0010700	Process	Negative regulation of norepinephrine secretion	NAS	16531006
GO:0010700	Process	Negative regulation of norepinephrine secretion	TAS	19477270
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0032811	Process	Negative regulation of epinephrine secretion	NAS	16531006
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	17215105
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IDA	17215105
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0051379	Function	Epinephrine binding	IBA
GO:0051379	Function	Epinephrine binding	IDA	17215105
GO:0051379	Function	Epinephrine binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17215105
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IEA
GO:0071875	Process	Adrenergic receptor signaling pathway	IDA	17215105

Other IDs

• MIM: 104260
• HGNC: 282
• e!Ensembl: ENSG00000274286

Protein

• UniProt ID: P18089
• Protein name: Alpha-2B adrenergic receptor (Alpha-2 adrenergic receptor subtype C2) (Alpha-2B adrenoreceptor) (Alpha-2B adrenoceptor) (Alpha-2BAR)
• Protein function: Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline
• PDB: 6K41, 6K42
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	29 → 426	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
  VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
  NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
  FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
  ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
  EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
  AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
  LNPVIYTIFNQDFRRAFRRILCRPWTQTAW

• Sequence length: 450

Pathways

KEGG:

cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Adrenoceptors
Adrenaline signalling through Alpha-2 adrenergic receptor
G alpha (i) signalling events
G alpha (z) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADRA2B-related disorder	not provided; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN ADULT FAMILIAL MYOCLONIC EPILEPSY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYANOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, familial adult myoclonic, 2	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
EPILEPSY, MYOCLONIC, BENIGN ADULT FAMILIAL, TYPE 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ADULT MYOCLONIC EPILEPSY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE DERMATOMYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acrodysostosis	Acrodysostosis	BEFREE	22723333, 23043190		★☆☆☆☆ Found in Text Mining only
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30596995		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8702478		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27588474, 28428987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29971639		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28653505		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28428987		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11092974		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	8571935	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27248167, 28360038		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20705147, 23103692, 25740197, 30812033		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	21854681	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20705147, 23103692, 25740197, 30812033		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30371299		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	11027943, 29393391		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12401126, 19840952, 27811230, 29991487, 31191301, 31500846, 31710686		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19247167, 30576947		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11728229, 15764725, 15947423, 17154652, 18588753, 20705147, 21392828, 28754608, 30335499		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12401126, 19840952, 27811230, 29991487, 31191301, 31500846, 31710686		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21499268, 22897819, 28912643, 28948080		★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	10770217		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28763059		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12086852, 25293589, 25354317, 30409535, 30510193, 30827936		★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypocalcemia	Hypocalcemia	BEFREE	10770217		★☆☆☆☆ Found in Text Mining only
Bartter Disease	Bartter syndrome	BEFREE	27339034		★☆☆☆☆ Found in Text Mining only
Benign adult familial myoclonic epilepsy	Benign Myoclonic Epilepsy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18386288		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	3955238	Associate	★☆☆☆☆ Found in Text Mining only
Blepharospasm	Blepharospasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10449749	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	12808434		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29949238		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11897506, 16397244, 19584257, 19622769, 23500535, 24599592, 26985934, 28209621, 30760632, 9367686		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24599592, 30279141	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	12808434		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	30670596		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22961449	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22715397, 28849235, 30321617		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25172843		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10537322, 17442564, 19010824, 19331211		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18953403, 26248277, 29166798, 29848777, 31236974		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18953403	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22560155		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28428987		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	25001852		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31785110		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21936770		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28877377, 30811196		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31132237		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20979106, 29971639		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25701758, 28875496		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11906480, 15225142, 16501306, 20100464, 21622221, 24702056, 27297948, 28698218, 29166798, 30171848, 30538174, 30538631, 31236974, 31785110		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	28870781		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23969937		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16776624, 19781422, 29097450, 30840026		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16776624, 19781422, 29097450, 30596995, 30840026		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16776624, 19781422, 19815603, 29097450, 30840026		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	16687567, 16926383, 17028442, 18161478, 21467199		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27471203		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	21854681	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28229904, 29305581, 31076569		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	26576537		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30733609		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17277585, 21392828		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17277585, 21392828, 28358422		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18953403, 33900865	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19476565		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15309292, 17277585, 18037923, 18953403, 20692245, 20816753, 23226241, 24946790, 28105282, 28363772, 28734639, 29466332, 29684031, 30154102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17516297		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	12107237		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	19331211		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16239258, 23235274		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23458722		★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	26854024		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24114805		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, FAMILIAL ADULT MYOCLONIC, 1	Myoclonic Epilepsy	ORPHANET_DG	24114805		★☆☆☆☆ Found in Text Mining only
EPILEPSY, MYOCLONIC, BENIGN ADULT FAMILIAL, TYPE 2	Myoclonic Epilepsy	GENOMICS_ENGLAND_DG	11701600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, MYOCLONIC, BENIGN ADULT FAMILIAL, TYPE 2	Myoclonic Epilepsy	BEFREE	30596995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17442564, 19331211		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18953403, 25732908		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	18953403, 32293282	Associate	★☆☆☆☆ Found in Text Mining only
Familial benign hypercalcemia	Hypocalciuric hypercalcemia	BEFREE	20846291		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28233865		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17611713, 21503828, 24790104, 28051998, 29949238		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17611713, 21503828, 21900396, 24790104, 28051998, 29949238		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18991757, 30638950		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23039881		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11906480, 15225142, 16501306, 20100464, 21622221, 24702056, 27297948, 28698218, 29166798, 30171848, 30538174, 30538631, 31236974		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34868339	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30541874		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	10087195		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	8001158		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20708032, 8626439		★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis, Non-Immune	Hydrops Fetalis	BEFREE	30115739		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28338186		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29022064		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18953403, 29027816, 33900865	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	14744925, 15225142, 16439609, 16481879, 18370232, 19593211, 25150869, 26244553, 28412414, 29027816, 30075183, 30812033		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	14744925, 18953403		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	BEFREE	29669745		★☆☆☆☆ Found in Text Mining only
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	BEFREE	15598687, 17164310		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	30975883		★☆☆☆☆ Found in Text Mining only
HYPOTRICHOSIS 8	Hypotrichosis	BEFREE	18461368		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37653539	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	15598687		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	21937992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31272268		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22560155, 25937634		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	18285834, 24830383		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10364352, 10438939, 10662620, 11289142, 11418689, 11504542, 12620408, 15003988, 16904612, 17329974, 17483315, 17881360, 18802460, 19915163, 20213674, 20660728, 20818438, 21159881, 21559457, 22942256, 23269549, 24292677, 28161489, 30308321, 31838186, 8892957		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28596381, 30305310		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	15097244		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15143072		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15039279, 26220344, 28428987, 30223538, 31032748		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11092974		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17259344, 29704239, 30061721		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17259344		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	20729197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	25640674, 28273093		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	19138979, 20686609, 28653505		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8892957		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20493668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11897506, 16397244, 19584257, 22927430, 23500535, 24599592, 26985934, 30760632, 9367686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16239258, 23235274		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22715397, 25744720, 26462152, 28849235, 30321617		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10537322, 19010824		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23056513, 28114355, 28260499		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11118034, 11593396, 15688318, 16206286, 19305425, 21500190, 23468933, 23803082, 28768769, 29663374, 30417466, 30775647, 30928381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15650023, 17130136		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22992343, 28759023, 30258285, 31832002		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11832457, 15492257, 17188489, 19593211, 19726788, 19755124, 21084381, 21159881, 22942256, 23269549, 23497290, 23500535, 24508914, 24599592, 25970609, 26854063, 26893368, 27601164, 27715394, 28223438, 28618224, 28673732, 29165389, 29268141, 29483837, 29614094, 29921886, 30510193, 30559168, 30775647, 31496800, 31500846, 31630880, 31659944, 31787357		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20979106, 29971639		★☆☆☆☆ Found in Text Mining only
Malpuech facial clefting syndrome	Malpuech facial clefting syndrome	Pubtator	12871468, 7620188	Associate	★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24252460		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15322701, 18583061, 19338054, 22273393, 28223438, 30267482		★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28229904, 29305581, 31076569		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27046448		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25364818		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25246581, 27215467, 28691227, 29655980		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19593211		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	20651814		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32632093	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	23499426		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28229904		★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	30482667		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22591013		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28052250, 30131588		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	9763559	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12401126, 28412414, 28798316, 30309470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	12535806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	12535806	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	11289142, 12150333, 12620408, 17894856, 20855608, 21102457, 21385899, 21559457, 22942256, 23269549, 23651229, 23979133, 24853422, 24882516, 25174588, 25194819, 25434383, 25701758, 27248167, 28152577, 29704239, 29749524, 31168089, 9284742		★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	12824183		★☆☆☆☆ Found in Text Mining only
Nephrogenic Syndrome of Inappropriate Antidiuresis	Nephrogenic Syndrome Of Inappropriate Antidiuresis	BEFREE	31486901		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31025859		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21299846		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28763059		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23144692, 27669169		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10903341, 18037923, 20462274, 24946790, 25970609, 31002796, 31288724		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	12917501	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	30658193	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	12917501	Associate	★☆☆☆☆ Found in Text Mining only
Ocular albinism, type I	Ocular albinism	BEFREE	16646960, 31275171		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28673732, 29277692, 30975883		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10537322, 19010824		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	29277692		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23056513, 28114355, 28260499		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27248167, 28360038		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26941397		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	27760455		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30993114		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	22333914, 23754170		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	17370102		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	8571935	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	24155306, 28115477, 28254464		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27588474		★☆☆☆☆ Found in Text Mining only
Priapism	Priapism	BEFREE	29394072		★☆☆☆☆ Found in Text Mining only
Primary pigmented nodular adrenocortical disease	Pigmented Nodular Adrenocortical Disease	BEFREE	22691887		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11118034, 11593396, 15688318, 16206286, 19305425, 21500190, 23468933, 23803082, 29663374, 30417466, 30775647, 30928381		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11593396		★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	BEFREE	29387507		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	29027816	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	11858796		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27297948		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25216639		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	19955366, 27694816		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11247813, 8889552		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10094932, 15225142		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	17872384		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	21784156		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20158934, 21784156, 28763059, 29497362, 30710087, 31704949		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	21618827		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30503722		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	15274044		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18057535		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31611744		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24568968		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28233865		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22992343, 28759023, 30258285, 31832002		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23344946		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	29025761		★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	12424194, 12506038, 12871468, 16879215, 18791937, 22394243, 25827233, 29385657, 33276370, 34275420, 40239810, 7620188, 9722314, 9739052, 9763559	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	33276370	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18451066		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	15225142		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	18461368		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24599592		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30872391		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29739919	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18719078, 27089179, 28223438, 30352874		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30586762		★☆☆☆☆ Found in Text Mining only
Vibratory urticaria	Vibratory urticaria	BEFREE	29454835		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease, Type 1	von Willebrand disorder	BEFREE	26630678		★☆☆☆☆ Found in Text Mining only