Gene Gene information from NCBI Gene database.
Entrez ID 150353
Gene name DnaJ heat shock protein family (Hsp40) member B7
Gene symbol DNAJB7
Synonyms (NCBI Gene)
DJ5HSC3
Chromosome 22
Chromosome location 22q13.2
Summary The protein encoded by this intronless gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-
miRNA miRNA information provided by mirtarbase database.
74
miRTarBase ID miRNA Experiments Reference
MIRT940296 hsa-miR-1237 CLIP-seq
MIRT940297 hsa-miR-1245b-5p CLIP-seq
MIRT940298 hsa-miR-1248 CLIP-seq
MIRT940299 hsa-miR-150 CLIP-seq
MIRT940300 hsa-miR-181a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0006457 Process Protein folding IBA
GO:0006457 Process Protein folding IEA
GO:0030544 Function Hsp70 protein binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611336 24986 ENSG00000172404
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z6W7
Protein name DnaJ homolog subfamily B member 7
Protein function Probably acts as a co-chaperone.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 3 66 DnaJ domain Domain
Sequence
MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDE
KRDIYD
KYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLL
NRPGSSYGNRNRDAGYFFSTASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDNSG
MDNYISVTTSDKIVNGRNINTKKIIESDQEREAEDNGELTFFLVNSVANEEGFAKECSWR
TQSFNNYSPNSHSSKHVSQYTFVDNDEGGISWVTSNRDPPIFSAGVKEGGKRKKKKRKEV
QKKSTKRNC
Sequence length 309
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BIPOLAR DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
B-Cell Lymphomas B-Cell Lymphoma BEFREE 29061824
★☆☆☆☆
Found in Text Mining only
Fibroid Tumor Leiomyoma BEFREE 28947958
★☆☆☆☆
Found in Text Mining only
Head and Neck Carcinoma Head And Neck Carcinoma BEFREE 12081207, 21332579, 31623058
★☆☆☆☆
Found in Text Mining only
Lip and Oral Cavity Carcinoma Lip and Oral Cavity Carcinoma BEFREE 17595767, 23499553, 23634222, 29102932, 29522917
★☆☆☆☆
Found in Text Mining only
Malignant Head and Neck Neoplasm Head and neck cancer BEFREE 21332579, 31623058
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of mouth Malignant neoplasm of mouth BEFREE 17595767, 23499553, 23634222, 29102932, 29522917
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 27633099
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of tongue Malignant Neoplasm Of Tongue BEFREE 25633184
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 17968683, 24647829, 28092646, 28612520, 30569110
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 12081207, 18167129, 20067447, 23618529, 26458285, 28470144
★☆☆☆☆
Found in Text Mining only