YDJC (YdjC chitooligosaccharide deacetylase homolog)

Gene

• Entrez ID: 150223
• Gene name: YdjC chitooligosaccharide deacetylase homolog
• Gene symbol: YDJC
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q11.21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041237	hsa-miR-193b-3p	CLASH	23622248
MIRT040030	hsa-miR-615-3p	CLASH	23622248
MIRT038947	hsa-miR-28-3p	CLASH	23622248
MIRT036985	hsa-miR-877-3p	CLASH	23622248
MIRT563187	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT563185	hsa-miR-3651	PAR-CLIP	20371350
MIRT563186	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT407462	hsa-miR-4477a	PAR-CLIP	20371350
MIRT563184	hsa-miR-488-3p	PAR-CLIP	20371350
MIRT563187	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT563185	hsa-miR-3651	PAR-CLIP	20371350
MIRT563186	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT407462	hsa-miR-4477a	PAR-CLIP	20371350
MIRT563184	hsa-miR-488-3p	PAR-CLIP	20371350
MIRT1498390	hsa-miR-1184	CLIP-seq
MIRT1498391	hsa-miR-1245b-5p	CLIP-seq
MIRT1498392	hsa-miR-1263	CLIP-seq
MIRT1498393	hsa-miR-3064-3p	CLIP-seq
MIRT1498394	hsa-miR-3142	CLIP-seq
MIRT1498395	hsa-miR-323b-5p	CLIP-seq
MIRT1498396	hsa-miR-3936	CLIP-seq
MIRT1498397	hsa-miR-421	CLIP-seq
MIRT1498398	hsa-miR-4438	CLIP-seq
MIRT1498399	hsa-miR-4450	CLIP-seq
MIRT1498400	hsa-miR-4473	CLIP-seq
MIRT1498401	hsa-miR-4671-3p	CLIP-seq
MIRT1498402	hsa-miR-4709-5p	CLIP-seq
MIRT1498403	hsa-miR-4763-5p	CLIP-seq
MIRT1498404	hsa-miR-505	CLIP-seq
MIRT1498405	hsa-miR-512-3p	CLIP-seq
MIRT1498406	hsa-miR-520f	CLIP-seq
MIRT1498407	hsa-miR-578	CLIP-seq
MIRT1498408	hsa-miR-636	CLIP-seq
MIRT2150102	hsa-miR-105	CLIP-seq
MIRT2150103	hsa-miR-1913	CLIP-seq
MIRT2150104	hsa-miR-3184	CLIP-seq
MIRT2150105	hsa-miR-3189-5p	CLIP-seq
MIRT2150106	hsa-miR-324-3p	CLIP-seq
MIRT2150107	hsa-miR-33a	CLIP-seq
MIRT2150108	hsa-miR-33b	CLIP-seq
MIRT2150109	hsa-miR-423-5p	CLIP-seq
MIRT2150110	hsa-miR-4688	CLIP-seq
MIRT2150111	hsa-miR-4758-3p	CLIP-seq
MIRT2150112	hsa-miR-4802-3p	CLIP-seq
MIRT2150113	hsa-miR-4802-5p	CLIP-seq
MIRT2150114	hsa-miR-493	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	ISS
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019213	Function	Deacetylase activity	IBA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 619770
• HGNC: 27158
• e!Ensembl: ENSG00000161179

Protein

• UniProt ID: A8MPS7
• Protein name: Carbohydrate deacetylase (EC 3.5.1.-)
• Protein function: Probably catalyzes the deacetylation of acetylated carbohydrates an important step in the degradation of oligosaccharides.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04794	YdjC	7 → 288	YdjC-like protein	Family

• Sequence:

  MSRPRMRLVVTADDFGYCPRRDEGIVEAFLAGAVTSVSLLVNGAATESAAELARRHSIPT
  GLHANLSEGRPVGPARRGASSLLGPEGFFLGKMGFREAVAAGDVDLPQVREELEAQLSCF
  RELLGRAPTHADGHQHVHVLPGVCQVFAEALQAYGVRFTRLPLERGVGGCTWLEAPARAF
  ACAVERDARAAVGPFSRHGLRWTDAFVGLSTCGRHMSAHRVSGALARVLEGTLAGHTLTA
  ELMAHPGYPSVPPTGGCGEGPDAFSCSWERLHELRVLTAPTLRAQLAQDGVQLCALDDLD
  SKRPGEEVPCEPTLEPFLEPSLL

• Sequence length: 323

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35507331	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	21383967		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34279042	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29796162		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASDB_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	27094594	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	27094594	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASCAT_DG	21383967		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23474282	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29796162		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22482804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	26398853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations