Gene Gene information from NCBI Gene database.
Entrez ID 1499
Gene name Catenin beta 1
Gene symbol CTNNB1
Synonyms (NCBI Gene)
CTNNBEVR7MRD19NEDSDVarmadillo
Chromosome 3
Chromosome location 3p22.1
Summary The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded prot
SNPs SNP information provided by dbSNP.
89
SNP ID Visualize variation Clinical significance Consequence
rs28931588 G>A,C,T Pathogenic, other, likely-pathogenic Missense variant, coding sequence variant
rs28931589 G>A,C,T Uncertain-significance, pathogenic, other, likely-pathogenic Missense variant, coding sequence variant
rs77064436 T>C,G Likely-pathogenic Coding sequence variant, missense variant
rs121913228 T>C,G Likely-pathogenic Missense variant, coding sequence variant
rs121913394 G>A Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
314
miRTarBase ID miRNA Experiments Reference
MIRT001175 hsa-miR-200a-3p qRT-PCRLuciferase reporter assayWestern blot 19703993
MIRT001175 hsa-miR-200a-3p qRT-PCRLuciferase reporter assayWestern blot 19703993
MIRT001175 hsa-miR-200a-3p Luciferase reporter assay 19703993
MIRT001175 hsa-miR-200a-3p Luciferase reporter assayqRT-PCRWestern blot 19931509
MIRT001557 hsa-miR-155-5p pSILAC 18668040
Transcription factors Transcription factors information provided by TRRUST V2 database.
10
Transcription factor Regulation Reference
AR Activation 18535113
ESR1 Repression 16628468
LEF1 Unknown 11326276
NELFCD Repression 20735431
NKX2-5 Unknown 19479054
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
363
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000165 Process MAPK cascade IEA
GO:0000209 Process Protein polyubiquitination IDA 29374064
GO:0000578 Process Embryonic axis specification IEA
GO:0000791 Component Euchromatin IDA 22723415
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
116806 2514 ENSG00000168036
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P35222
Protein name Catenin beta-1 (Beta-catenin)
Protein function Key downstream component of the canonical Wnt signaling pathway (PubMed:17524503, PubMed:18077326, PubMed:18086858, PubMed:18957423, PubMed:21262353, PubMed:22155184, PubMed:22647378, PubMed:22699938). In the absence of Wnt, forms a complex with
PDB 1G3J , 1JDH , 1JPW , 1LUJ , 1P22 , 1QZ7 , 1T08 , 1TH1 , 2G57 , 2GL7 , 2Z6H , 3DIW , 3FQN , 3FQR , 3SL9 , 3SLA , 3TX7 , 4DJS , 6M90 , 6M91 , 6M92 , 6M93 , 6M94 , 6O9B , 6O9C , 6WLX , 6WNX , 7AFW , 7AR4 , 7UWI , 7UWO , 7ZRB , 8EI9 , 8EIA , 8EIB , 8EIC , 8RU3 , 8RU4 , 8VME , 8VMF , 8Y0G , 8Y0P , 8Y14 , 8Z0U , 8Z10 , 8Z5J , 8Z61
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00514 Arm 224 263 Armadillo/beta-catenin-like repeat Repeat
PF00514 Arm 350 390 Armadillo/beta-catenin-like repeat Repeat
PF00514 Arm 431 473 Armadillo/beta-catenin-like repeat Repeat
PF00514 Arm 583 623 Armadillo/beta-catenin-like repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in several hair follicle cell types: basal and peripheral matrix cells, and cells of the outer and inner root sheaths. Expressed in colon. Present in cortical neurons (at protein level). Expressed in breast cancer tissues (at
Sequence
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLL
LHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSD
AATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQ
DKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
Sequence length 781
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Rap1 signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Focal adhesion
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Leukocyte transendothelial migration
Melanogenesis
Thyroid hormone signaling pathway
Cushing syndrome
Alcoholic liver disease
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Bacterial invasion of epithelial cells
Salmonella infection
Hepatitis C
Human cytomegalovirus infection
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Arrhythmogenic right ventricular cardiomyopathy
Fluid shear stress and atherosclerosis
  Degradation of beta-catenin by the destruction complex
Beta-catenin phosphorylation cascade
TCF dependent signaling in response to WNT
Formation of the beta-catenin:TCF transactivating complex
LRR FLII-interacting protein 1 (LRRFIP1) activates type I IFN production
Apoptotic cleavage of cell adhesion proteins
Deactivation of the beta-catenin transactivating complex
Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
Ca2+ pathway
Adherens junctions interactions
Binding of TCF/LEF:CTNNB1 to target gene promoters
Disassembly of the destruction complex and recruitment of AXIN to the membrane
VEGFR2 mediated vascular permeability
Myogenesis
Misspliced GSK3beta mutants stabilize beta-catenin
S33 mutants of beta-catenin aren't phosphorylated
S37 mutants of beta-catenin aren't phosphorylated
S45 mutants of beta-catenin aren't phosphorylated
T41 mutants of beta-catenin aren't phosphorylated
RHO GTPases activate IQGAPs
Transcriptional Regulation by VENTX
InlA-mediated entry of Listeria monocytogenes into host cells
RUNX3 regulates WNT signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
122
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormal lung growth, pulmonary hypertension, microcephaly, and spasticity Pathogenic rs886039332 RCV000984346
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Abnormality of the nervous system Likely pathogenic rs2125645060 RCV001814516
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Absent speech Likely pathogenic rs1553632357 RCV000626747
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Adamantinous craniopharyngioma Pathogenic; Likely pathogenic rs121913400, rs121913396, rs121913403, rs121913412, rs28931588, rs28931589, rs121913413, rs121913399 RCV006253629
RCV006253632
RCV006253636
RCV006253641
RCV006253645
View all (7 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANUS, IMPERFORATE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Absent antitragus Absent Antitragus CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Acute Erythroblastic Leukemia Erythroblastic Leukemia BEFREE 20503246, 21298772
★☆☆☆☆
Found in Text Mining only
Acute Kidney Tubular Necrosis Renal tubular necrosis BEFREE 23850018
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 11522623
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 15257703, 17148581, 17156404, 17614820, 24995804, 27987331
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 28611040, 28978671, 29512829, 30305722, 30674535
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 30140950, 30326193
★☆☆☆☆
Found in Text Mining only
Acute Undifferentiated Leukemia Leukemia BEFREE 23519466, 25248926, 29932919
★☆☆☆☆
Found in Text Mining only
Adamantinous Craniopharyngioma Adamantinous Craniopharyngioma BEFREE 12466115, 14578169, 15980970, 21761366, 22349813, 23560577, 24356780, 25355426, 26763580, 27903120, 27903124, 27903126, 28658279, 28840946, 29180744
View all (6 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Adamantinous Craniopharyngioma Adamantinous Craniopharyngioma CTD_human_DG 24413733
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)