Gene Gene information from NCBI Gene database.
Entrez ID 1497
Gene name Cystinosin, lysosomal cystine transporter
Gene symbol CTNS
Synonyms (NCBI Gene)
CTNS-LSBPQLC4SLC66A4
Chromosome 17
Chromosome location 17p13.2
Summary This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage
SNPs SNP information provided by dbSNP.
4
SNP ID Visualize variation Clinical significance Consequence
rs121908127 G>A Pathogenic Coding sequence variant, missense variant
rs375952052 G>A,C Likely-pathogenic, pathogenic Intron variant
rs1057517330 T>C Likely-pathogenic Stop lost, intron variant, terminator codon variant
rs1555564823 ->G Likely-pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
452
miRTarBase ID miRNA Experiments Reference
MIRT022765 hsa-miR-124-3p Microarray 18668037
MIRT029732 hsa-miR-26b-5p Microarray 19088304
MIRT044666 hsa-miR-320a CLASH 23622248
MIRT650943 hsa-miR-6819-3p HITS-CLIP 23824327
MIRT650942 hsa-miR-6877-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
GO ID Ontology Definition Evidence Reference
GO:0002088 Process Lens development in camera-type eye IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005764 Component Lysosome IDA 11855931, 12138135, 15128704, 18337546
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane HDA 17897319
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606272 2518 ENSG00000040531
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60931
Protein name Cystinosin
Protein function Cystine/H(+) symporter that mediates export of cystine, the oxidized dimer of cysteine, from lysosomes (PubMed:11689434, PubMed:15128704, PubMed:18337546, PubMed:22232659, PubMed:29467429, PubMed:33208952, PubMed:36113465). Plays an important ro
PDB 8DKE , 8DKI , 8DKM , 8DKW , 8DKX , 8DYP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04193 PQ-loop 126 186 PQ loop repeat Repeat
PF04193 PQ-loop 265 325 PQ loop repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in pancreas, kidney (adult and fetal), skeletal muscle, melanocytes and keratinocytes (PubMed:22649030). Expressed at lower levels in placenta and heart. Weakly expressed in lung, liver and brain (adult and fetal) (P
Sequence
MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEI
TFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRS
SAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGFVAYSVFNIGL
LWVPYI
KEQFLLKYPNGVNPVNSNDVFFSLHAVVLTLIIIVQCCLYERGGQRVSWPAIGF
LVLAWLFAFVTMIVAAVGVTTWLQFLFCFSYIKLAVTLVKYFPQAYMNFYYKSTEGWSIG
NVLLDFTGGSFSLLQMFLQSYNNDQ
WTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKR
PGYDQLN
Sequence length 367
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Lysosome   Transport of inorganic cations/anions and amino acids/oligopeptides
Miscellaneous transport and binding events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
CTNS-related disorder Likely pathogenic; Pathogenic rs2150889009, rs786204501, rs113994205, rs121908127, rs113994206, rs113994209, rs113994211, rs879758262, rs1463026342 RCV005867007
RCV003917579
RCV005222667
RCV003904807
RCV004748534
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cystinosis Likely pathogenic; Pathogenic rs776658046, rs2150925451, rs2142982656, rs1597654770, rs786204501, rs786204667, rs760256854, rs786204420, rs113994205, rs113994207, rs121908127, rs267606754, rs2507794316, rs2507777392, rs879255615
View all (28 more)
RCV005420398
RCV005420402
RCV006249789
RCV005420424
RCV005419883
View all (38 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cystinosis, atypical nephropathic Pathogenic; Likely pathogenic rs121908129, rs267606754 RCV000004710
RCV000004712
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer Pathogenic rs749317721 RCV005909147
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Uncertain significance; Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CYSTINOSIS, ADULT NONNEPHROPATHIC HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Fanconi syndrome Fanconi syndrome BEFREE 15365816, 27990015
★☆☆☆☆
Found in Text Mining only
Adult Fanconi syndrome Fanconi syndrome HPO_DG
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone Disease BEFREE 29365190
★☆☆☆☆
Found in Text Mining only
Cakut Congenital anomalies of the kidney and urinary tract Pubtator 27151922 Associate
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic kidney disease stage 5 Kidney Disease HPO_DG
★☆☆☆☆
Found in Text Mining only
Cystinosis Cystinosis BEFREE 10417278, 10556299, 10571941, 11505338, 11708862, 11855931, 12138135, 12204010, 12442267, 15128704, 15264281, 15365816, 15465007, 17471495, 17643777
View all (35 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cystinosis Cystinosis Pubtator 10417278, 11505338, 15879904, 20352457, 21786142, 22450360, 22786804, 23640116, 25071085, 25165189, 25866837, 25947233, 26565940, 26915455, 27083281
View all (30 more)
Associate
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cystinosis Cystinosis CLINVAR_DG 10556299, 10571941, 10625078, 11505338, 11562417, 11708862, 12204010, 12442267, 12644911, 15128704, 18752449, 19580442, 19863563, 21305353, 21786142
View all (10 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cystinosis Cystinosis CTD_human_DG 15879904
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)