ADIG (adipogenin)

Gene

• Entrez ID: 149685
• Gene name: Adipogenin
• Gene symbol: ADIG
• Synonyms (NCBI Gene): SMAF1
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: ADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation (Kim et al., 2005 [PubMed 15567149]; Hong et al., 2005 [PubMed 16132694]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017353	hsa-miR-335-5p	Microarray	18185580
MIRT768784	hsa-miR-1178	CLIP-seq
MIRT768785	hsa-miR-1275	CLIP-seq
MIRT768786	hsa-miR-1321	CLIP-seq
MIRT768787	hsa-miR-219-1-3p	CLIP-seq
MIRT768788	hsa-miR-2861	CLIP-seq
MIRT768789	hsa-miR-3202	CLIP-seq
MIRT768790	hsa-miR-331-3p	CLIP-seq
MIRT768791	hsa-miR-3612	CLIP-seq
MIRT768792	hsa-miR-3622a-3p	CLIP-seq
MIRT768793	hsa-miR-3622b-3p	CLIP-seq
MIRT768794	hsa-miR-4259	CLIP-seq
MIRT768795	hsa-miR-4270	CLIP-seq
MIRT768796	hsa-miR-4308	CLIP-seq
MIRT768797	hsa-miR-4441	CLIP-seq
MIRT768798	hsa-miR-4512	CLIP-seq
MIRT768799	hsa-miR-4533	CLIP-seq
MIRT768800	hsa-miR-4665-5p	CLIP-seq
MIRT768801	hsa-miR-4685-5p	CLIP-seq
MIRT768802	hsa-miR-4739	CLIP-seq
MIRT768803	hsa-miR-4756-5p	CLIP-seq
MIRT768804	hsa-miR-571	CLIP-seq
MIRT768805	hsa-miR-650	CLIP-seq
MIRT768806	hsa-miR-767-3p	CLIP-seq
MIRT1926732	hsa-miR-4713-5p	CLIP-seq
MIRT2167686	hsa-miR-345	CLIP-seq
MIRT2167687	hsa-miR-370	CLIP-seq
MIRT2167688	hsa-miR-508-5p	CLIP-seq
MIRT2167689	hsa-miR-628-5p	CLIP-seq
MIRT2167690	hsa-miR-665	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	15567149
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	15567149
GO:0005811	Component	Lipid droplet	IBA
GO:0005811	Component	Lipid droplet	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016020	Component	Membrane	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS	15567149
GO:0050872	Process	White fat cell differentiation	IBA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IBA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	ISS	15567149

Other IDs

• MIM: 611396
• HGNC: 28606
• e!Ensembl: ENSG00000182035

Protein

• UniProt ID: Q0VDE8
• Protein name: Adipogenin
• Protein function: Plays a role in stimulating adipocyte differentiation and development.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15202	Adipogenin	1 → 78	Adipogenin	Family

• Sequence:

  MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKG
  PAEFCWKGTLHGQEKERPCW

• Sequence length: 80

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Metabolic Diseases	Metabolic Diseases	BEFREE	23197810		★☆☆☆☆ Found in Text Mining only