Gene Gene information from NCBI Gene database.
Entrez ID 149628
Gene name Pyrin and HIN domain family member 1
Gene symbol PYHIN1
Synonyms (NCBI Gene)
IFIX
Chromosome 1
Chromosome location 1q23.1
Summary The protein encoded by this gene belongs to the HIN-200 family of interferon-inducible proteins that share a 200-amino acid signature motif at their C-termini. HIN200 proteins are primarily nuclear and are involved in transcriptional regulation of genes i
miRNA miRNA information provided by mirtarbase database.
97
miRTarBase ID miRNA Experiments Reference
MIRT509223 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT509222 hsa-miR-205-3p HITS-CLIP 21572407
MIRT509221 hsa-miR-190a-3p HITS-CLIP 21572407
MIRT509220 hsa-miR-1277-5p HITS-CLIP 21572407
MIRT509223 hsa-miR-5011-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0002218 Process Activation of innate immune response IBA
GO:0002218 Process Activation of innate immune response IEA
GO:0003690 Function Double-stranded DNA binding IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612677 28894 ENSG00000163564
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6K0P9
Protein name Pyrin and HIN domain-containing protein 1 (Interferon-inducible protein X)
Protein function Major mediator of the tumor suppressor activity of IFN in breast cancer cells. Promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization. Promotes ubiquitination and subsequent degradation of HDAC1, which
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02758 PYRIN 8 80 PAAD/DAPIN/Pyrin domain Domain
PF02760 HIN 211 379 HIN-200/IF120x domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, lymph node and peripheral blood leukocytes, and at lower levels in thymus, bone marrow and fetal liver. Down-regulated in breast tumors. {ECO:0000269|PubMed:15122330}.
Sequence
MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDA
GLGKLIEFFKEIPTLGDLAE
TLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACT
PSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQ
TSSSAPPNTSSTESLKPLANRHATASKNIFREDPIIAMVLNATKVFKYESSENEQRRMFH
ATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSLLEVNEASSVSEAGPDQTFEV
PKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKTGSMAVVGKGE
CHNIPCEKGDKLRLFCFRL
RKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQ
HPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLS
SDTSTNRHPAVP
Sequence length 492
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA CTD, GWAS catalog
CTD, GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Prostate cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PYHIN1-related disorder Uncertain significance; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthma Asthma BEFREE 21804549, 23666277, 25895113
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma GWASCAT_DG 21804549
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma CTD_human_DG 21804549
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma GWASDB_DG 21804549
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma Pubtator 25895113 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast Carcinoma Breast Carcinoma BEFREE 15122330
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 16479015, 34599264 Inhibit
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 16479015 Associate
★☆☆☆☆
Found in Text Mining only
Colitis Ulcerative Ulcerative colitis Pubtator 36165492 Stimulate
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory bowel disease Pubtator 25895113 Associate
★☆☆☆☆
Found in Text Mining only