Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	149428
Gene name	BCL2 interacting protein like
Gene symbol	BNIPL
Synonyms (NCBI Gene)	BNIP-SBNIP-SalphaBNIP-SbetaBNIPL-1BNIPL-2BNIPL1BNIPL2BNIPSPP753
Chromosome	1
Chromosome location	1q21.3
Summary	The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding di

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments
MIRT823521	hsa-miR-3122	CLIP-seq
MIRT823522	hsa-miR-335	CLIP-seq
MIRT823523	hsa-miR-3689a-3p	CLIP-seq
MIRT823524	hsa-miR-3689c	CLIP-seq
MIRT823525	hsa-miR-3913-5p	CLIP-seq
MIRT823526	hsa-miR-4537	CLIP-seq
MIRT823527	hsa-miR-4728-5p	CLIP-seq
MIRT823528	hsa-miR-4786-5p	CLIP-seq
MIRT823529	hsa-miR-4793-3p	CLIP-seq
MIRT823530	hsa-miR-4793-5p	CLIP-seq
MIRT823531	hsa-miR-508-5p	CLIP-seq
MIRT823532	hsa-miR-658	CLIP-seq
MIRT823533	hsa-miR-766	CLIP-seq
MIRT823534	hsa-miR-1228	CLIP-seq
MIRT823535	hsa-miR-135a	CLIP-seq
MIRT823536	hsa-miR-135b	CLIP-seq
MIRT823537	hsa-miR-1827	CLIP-seq
MIRT823538	hsa-miR-24	CLIP-seq
MIRT823539	hsa-miR-298	CLIP-seq
MIRT823540	hsa-miR-3176	CLIP-seq
MIRT823541	hsa-miR-342-3p	CLIP-seq
MIRT823542	hsa-miR-3922-3p	CLIP-seq
MIRT823543	hsa-miR-4284	CLIP-seq
MIRT1943494	hsa-miR-1273	CLIP-seq
MIRT823537	hsa-miR-1827	CLIP-seq
MIRT823539	hsa-miR-298	CLIP-seq
MIRT823526	hsa-miR-4537	CLIP-seq
MIRT823529	hsa-miR-4793-3p	CLIP-seq
MIRT823531	hsa-miR-508-5p	CLIP-seq
MIRT823533	hsa-miR-766	CLIP-seq
MIRT823526	hsa-miR-4537	CLIP-seq
MIRT823529	hsa-miR-4793-3p	CLIP-seq
MIRT823531	hsa-miR-508-5p	CLIP-seq
MIRT823532	hsa-miR-658	CLIP-seq
MIRT823533	hsa-miR-766	CLIP-seq
MIRT1943494	hsa-miR-1273	CLIP-seq
MIRT823529	hsa-miR-4793-3p	CLIP-seq
MIRT823531	hsa-miR-508-5p	CLIP-seq
MIRT2384845	hsa-miR-720	CLIP-seq
MIRT823533	hsa-miR-766	CLIP-seq
MIRT823534	hsa-miR-1228	CLIP-seq
MIRT2444862	hsa-miR-1268	CLIP-seq
MIRT2444863	hsa-miR-1268b	CLIP-seq
MIRT1943494	hsa-miR-1273	CLIP-seq
MIRT2444864	hsa-miR-1307	CLIP-seq
MIRT2444865	hsa-miR-216a	CLIP-seq
MIRT2444866	hsa-miR-216b	CLIP-seq
MIRT823521	hsa-miR-3122	CLIP-seq
MIRT823523	hsa-miR-3689a-3p	CLIP-seq
MIRT823524	hsa-miR-3689c	CLIP-seq
MIRT823525	hsa-miR-3913-5p	CLIP-seq
MIRT2444867	hsa-miR-4486	CLIP-seq
MIRT2444868	hsa-miR-4638-5p	CLIP-seq
MIRT2444869	hsa-miR-4684-5p	CLIP-seq
MIRT823527	hsa-miR-4728-5p	CLIP-seq
MIRT823529	hsa-miR-4793-3p	CLIP-seq
MIRT823531	hsa-miR-508-5p	CLIP-seq
MIRT2444870	hsa-miR-548c-3p	CLIP-seq
MIRT2444871	hsa-miR-585	CLIP-seq
MIRT823533	hsa-miR-766	CLIP-seq
MIRT823534	hsa-miR-1228	CLIP-seq
MIRT2444862	hsa-miR-1268	CLIP-seq
MIRT2444863	hsa-miR-1268b	CLIP-seq
MIRT1943494	hsa-miR-1273	CLIP-seq
MIRT2444864	hsa-miR-1307	CLIP-seq
MIRT2444865	hsa-miR-216a	CLIP-seq
MIRT2444866	hsa-miR-216b	CLIP-seq
MIRT823521	hsa-miR-3122	CLIP-seq
MIRT2485748	hsa-miR-3613-3p	CLIP-seq
MIRT823523	hsa-miR-3689a-3p	CLIP-seq
MIRT823524	hsa-miR-3689c	CLIP-seq
MIRT2485749	hsa-miR-371-5p	CLIP-seq
MIRT2485750	hsa-miR-371b-5p	CLIP-seq
MIRT823525	hsa-miR-3913-5p	CLIP-seq
MIRT2444867	hsa-miR-4486	CLIP-seq
MIRT2444868	hsa-miR-4638-5p	CLIP-seq
MIRT2444869	hsa-miR-4684-5p	CLIP-seq
MIRT823527	hsa-miR-4728-5p	CLIP-seq
MIRT823529	hsa-miR-4793-3p	CLIP-seq
MIRT823531	hsa-miR-508-5p	CLIP-seq
MIRT2444870	hsa-miR-548c-3p	CLIP-seq
MIRT2444871	hsa-miR-585	CLIP-seq
MIRT823533	hsa-miR-766	CLIP-seq
MIRT823534	hsa-miR-1228	CLIP-seq
MIRT2444862	hsa-miR-1268	CLIP-seq
MIRT2444863	hsa-miR-1268b	CLIP-seq
MIRT1943494	hsa-miR-1273	CLIP-seq
MIRT2444864	hsa-miR-1307	CLIP-seq
MIRT2444865	hsa-miR-216a	CLIP-seq
MIRT2444866	hsa-miR-216b	CLIP-seq
MIRT823521	hsa-miR-3122	CLIP-seq
MIRT2485748	hsa-miR-3613-3p	CLIP-seq
MIRT823523	hsa-miR-3689a-3p	CLIP-seq
MIRT823524	hsa-miR-3689c	CLIP-seq
MIRT2485749	hsa-miR-371-5p	CLIP-seq
MIRT2485750	hsa-miR-371b-5p	CLIP-seq
MIRT823525	hsa-miR-3913-5p	CLIP-seq
MIRT2444867	hsa-miR-4486	CLIP-seq
MIRT2444868	hsa-miR-4638-5p	CLIP-seq
MIRT2444869	hsa-miR-4684-5p	CLIP-seq
MIRT823527	hsa-miR-4728-5p	CLIP-seq
MIRT823529	hsa-miR-4793-3p	CLIP-seq
MIRT823531	hsa-miR-508-5p	CLIP-seq
MIRT2444870	hsa-miR-548c-3p	CLIP-seq
MIRT2444871	hsa-miR-585	CLIP-seq
MIRT823533	hsa-miR-766	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12681488, 12901880
GO:0005634	Component	Nucleus	IDA	11741952
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA	11741952
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	IDA	11741952
GO:0006915	Process	Apoptotic process	IDA	11741952
GO:0006915	Process	Apoptotic process	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	12681488
GO:0040009	Process	Regulation of growth rate	IDA	12681488
GO:0042802	Function	Identical protein binding	IPI	12901880

MIM	HGNC	e!Ensembl
611275	16976	ENSG00000163141

Q7Z465

Protein name

Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein

Protein function

May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12496	BNIP2	83 → 211	Bcl2-/adenovirus E1B nineteen kDa-interacting protein 2	Family
PF13716	CRAL_TRIO_2	212 → 350	Divergent CRAL/TRIO domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is expressed in placenta and lung. {ECO:0000269|PubMed:12681488}.

Sequence

MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPEEAGTSEDPED
PKGDSQAAAGTPSTLALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSD
LEIDELETPSDSEQLDSGHEFEWEDELPRAEGLGTSETAERLGRGCMWDVTGEDGHHWRV
FRMGPREQRVDMTVIEPYKKVLSHGGYHGDGLNAVILFASCYLPRSSIPNYTYVMEHLFR
YMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY
VKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT

Sequence length

357

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15112343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28901451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31485655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31485655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	38302910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15112343, 16143817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38286121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BNIPL (BCL2 interacting protein like)