Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	149233
Gene name	Interleukin 23 receptor
Gene symbol	IL23R
Synonyms (NCBI Gene)	PSORS7
Chromosome	1
Chromosome location	1p31.3
Summary	The protein encoded by this gene is a subunit of the receptor for IL23A/IL23. This protein pairs with the receptor molecule IL12RB1/IL12Rbeta1, and both are required for IL23A signaling. This protein associates constitutively with Janus kinase 2 (JAK2), a

210

Show/Hide all (210)

miRTarBase ID	miRNA	Experiments	Reference
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT646786	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT646784	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT646785	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT646783	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT646782	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT646781	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT646779	hsa-miR-3666	HITS-CLIP	23824327
MIRT646780	hsa-miR-4295	HITS-CLIP	23824327
MIRT646778	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT646777	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT646776	hsa-miR-148a-3p	HITS-CLIP	23824327
MIRT646775	hsa-miR-148b-3p	HITS-CLIP	23824327
MIRT646774	hsa-miR-152-3p	HITS-CLIP	23824327
MIRT646773	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	FlowLuciferase reporter assayqRT-PCR	25863684
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT646786	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT646784	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT646785	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT646783	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT646782	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT646781	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT646779	hsa-miR-3666	HITS-CLIP	23824327
MIRT646780	hsa-miR-4295	HITS-CLIP	23824327
MIRT646778	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT646777	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT646776	hsa-miR-148a-3p	HITS-CLIP	23824327
MIRT646775	hsa-miR-148b-3p	HITS-CLIP	23824327
MIRT646774	hsa-miR-152-3p	HITS-CLIP	23824327
MIRT646773	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT1064614	hsa-miR-1279	CLIP-seq
MIRT1064615	hsa-miR-1297	CLIP-seq
MIRT1064616	hsa-miR-1343	CLIP-seq
MIRT1064617	hsa-miR-150	CLIP-seq
MIRT1064618	hsa-miR-1976	CLIP-seq
MIRT1064619	hsa-miR-2052	CLIP-seq
MIRT1064620	hsa-miR-26a	CLIP-seq
MIRT1064621	hsa-miR-26b	CLIP-seq
MIRT1064622	hsa-miR-3126-5p	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064624	hsa-miR-3160-5p	CLIP-seq
MIRT1064625	hsa-miR-3187-3p	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064627	hsa-miR-3667-3p	CLIP-seq
MIRT1064628	hsa-miR-3714	CLIP-seq
MIRT1064629	hsa-miR-378	CLIP-seq
MIRT1064630	hsa-miR-378b	CLIP-seq
MIRT1064631	hsa-miR-378c	CLIP-seq
MIRT1064632	hsa-miR-378d	CLIP-seq
MIRT1064633	hsa-miR-378e	CLIP-seq
MIRT1064634	hsa-miR-378f	CLIP-seq
MIRT1064635	hsa-miR-378h	CLIP-seq
MIRT1064636	hsa-miR-378i	CLIP-seq
MIRT1064637	hsa-miR-422a	CLIP-seq
MIRT1064638	hsa-miR-4279	CLIP-seq
MIRT1064639	hsa-miR-4297	CLIP-seq
MIRT1064640	hsa-miR-4419a	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064643	hsa-miR-4435	CLIP-seq
MIRT1064644	hsa-miR-4465	CLIP-seq
MIRT1064645	hsa-miR-450b-5p	CLIP-seq
MIRT1064646	hsa-miR-4510	CLIP-seq
MIRT1064647	hsa-miR-4668-5p	CLIP-seq
MIRT1064648	hsa-miR-4678	CLIP-seq
MIRT1064649	hsa-miR-4701-5p	CLIP-seq
MIRT1064650	hsa-miR-4708-3p	CLIP-seq
MIRT1064651	hsa-miR-4715-3p	CLIP-seq
MIRT1064652	hsa-miR-4722-3p	CLIP-seq
MIRT1064653	hsa-miR-4755-3p	CLIP-seq
MIRT1064654	hsa-miR-507	CLIP-seq
MIRT1064655	hsa-miR-548s	CLIP-seq
MIRT1064656	hsa-miR-557	CLIP-seq
MIRT1064657	hsa-miR-562	CLIP-seq
MIRT1064658	hsa-miR-588	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT2015373	hsa-miR-216a	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT2015374	hsa-miR-668	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT1064615	hsa-miR-1297	CLIP-seq
MIRT1064616	hsa-miR-1343	CLIP-seq
MIRT1064618	hsa-miR-1976	CLIP-seq
MIRT2015373	hsa-miR-216a	CLIP-seq
MIRT1064620	hsa-miR-26a	CLIP-seq
MIRT1064621	hsa-miR-26b	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064627	hsa-miR-3667-3p	CLIP-seq
MIRT1064638	hsa-miR-4279	CLIP-seq
MIRT1064639	hsa-miR-4297	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064644	hsa-miR-4465	CLIP-seq
MIRT2389366	hsa-miR-28-5p	CLIP-seq
MIRT2389367	hsa-miR-3139	CLIP-seq
MIRT2389368	hsa-miR-708	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT2451749	hsa-miR-1324	CLIP-seq
MIRT2451750	hsa-miR-2054	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT2451751	hsa-miR-411	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064651	hsa-miR-4715-3p	CLIP-seq
MIRT2451752	hsa-miR-4735-5p	CLIP-seq
MIRT2451753	hsa-miR-4743	CLIP-seq
MIRT2451754	hsa-miR-4775	CLIP-seq
MIRT2451755	hsa-miR-4797-5p	CLIP-seq
MIRT2451756	hsa-miR-590-3p	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT1064615	hsa-miR-1297	CLIP-seq
MIRT2451749	hsa-miR-1324	CLIP-seq
MIRT1064616	hsa-miR-1343	CLIP-seq
MIRT1064618	hsa-miR-1976	CLIP-seq
MIRT1064620	hsa-miR-26a	CLIP-seq
MIRT1064621	hsa-miR-26b	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064627	hsa-miR-3667-3p	CLIP-seq
MIRT1064638	hsa-miR-4279	CLIP-seq
MIRT1064639	hsa-miR-4297	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064644	hsa-miR-4465	CLIP-seq
MIRT1064652	hsa-miR-4722-3p	CLIP-seq
MIRT2451755	hsa-miR-4797-5p	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT2451749	hsa-miR-1324	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT2451755	hsa-miR-4797-5p	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0004896	Function	Cytokine receptor activity	IDA	29287995
GO:0004925	Function	Prolactin receptor activity	IBA
GO:0005143	Function	Interleukin-12 receptor binding	IBA
GO:0005143	Function	Interleukin-12 receptor binding	IPI	12023369
GO:0005515	Function	Protein binding	IPI	12023369, 25416956
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IC	12023369
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	12023369
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019955	Function	Cytokine binding	IBA
GO:0032496	Process	Response to lipopolysaccharide	IDA	12023369
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IC	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IC	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11114383
GO:0032729	Process	Positive regulation of type II interferon production	TAS	19088061
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IC	17888176
GO:0032819	Process	Positive regulation of natural killer cell proliferation	TAS	19088061
GO:0034341	Process	Response to type II interferon	IDA	12023369
GO:0038155	Process	Interleukin-23-mediated signaling pathway	IDA	7528775, 12023369, 29287995
GO:0038155	Process	Interleukin-23-mediated signaling pathway	IDA	29287995
GO:0038161	Process	Prolactin signaling pathway	IEA
GO:0042019	Function	Interleukin-23 binding	IBA
GO:0042019	Function	Interleukin-23 binding	IPI	12023369
GO:0042020	Function	Interleukin-23 receptor activity	IDA	12023369
GO:0042102	Process	Positive regulation of T cell proliferation	IC	12023369
GO:0042104	Process	Positive regulation of activated T cell proliferation	IC	11114383
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IC	17888176
GO:0050829	Process	Defense response to Gram-negative bacterium	IC	15114670
GO:0051135	Process	Positive regulation of NK T cell activation	TAS	19088061
GO:0072536	Component	Interleukin-23 receptor complex	IBA
GO:0072536	Component	Interleukin-23 receptor complex	IDA	12023369
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	TAS	19088061
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

MIM	HGNC	e!Ensembl
607562	19100	ENSG00000162594

Q5VWK5

Protein name

Interleukin-23 receptor (IL-23 receptor) (IL-23R)

Protein function

Associates with IL12RB1 to form the interleukin-23 receptor. Binds IL23 and mediates T-cells, NK cells and possibly certain macrophage/myeloid cells stimulation probably through activation of the Jak-Stat signaling cascade. IL23 functions in inn

PDB

5MZV , 6WDQ , 8OE4

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed by monocytes, Th1, Th0, NK and dendritic cells. Isoform 1 is specifically expressed in NK cells. {ECO:0000269|PubMed:12023369, ECO:0000269|PubMed:16372191}.

Sequence

MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK

Sequence length

629

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Th17 cell differentiation Pathways in cancer Inflammatory bowel disease		Interleukin-4 and Interleukin-13 signaling Interleukin-23 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (53)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet disease	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL PRECOCIOUS PUBERTY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF PHARYNX	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHEMATOSQUAMOUS DERMATOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL23R-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory bowel disease 17	Benign; Likely benign	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Inflammatory bowel disease 17, protection against	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHIC OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis 7, susceptibility to	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis, protection against	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VOGT-KOYANAGI-HARADA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (294)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20622911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23250909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25015728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	22154103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21547355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	23696856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	26017027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	26017027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	24703098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28427357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	19165485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17952073		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	CTD_human_DG	17952073, 20062062		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	18082575, 18199597, 18368064, 18383363, 18525349, 19189980, 19369463, 19468994, 19496308, 19522770, 19541528, 19690863, 19757086, 19772829, 19877036 View all (34 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	20062062, 21743469, 23749187, 26301688, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASDB_DG	20062062, 21743469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	BEFREE	24312163		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior uveitis	Uveitis	GWASCAT_DG	25200001		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	29330562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25192515, 26261042, 29618473, 30328797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18800148, 30038617, 31778214		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	Pubtator	30299251	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Juvenile	Juvenile arthritis	Pubtator	21281511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	18369459, 18800148, 19035472, 21281511, 22298274, 24286492, 25651891, 27543964, 31677365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18073300, 18369459, 19021011, 20929536, 26062018, 28547498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28547498	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	18800148, 19035472, 19040306, 21281511, 22706445, 22955875, 23673284, 24910145, 24957500, 25651891, 26626624, 30196070, 30584776, 31541902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	19035472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	GWASCAT_DG	30552173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	23093722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19935773, 26547706, 27043356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21150878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26547706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25192515, 26261042, 29618473, 30328797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25192515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31655158		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17606463, 18073300, 18082575, 18199597, 19021011, 19317742, 19522770, 19747142, 19757086, 19918037, 20978829, 21484795, 21606346, 21846945, 22174698 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18073300, 19021011, 19165485, 19522770, 19918037, 21508257, 21606346, 21846945, 22022372, 24312163, 24395888, 24912586, 26228217, 31123953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	18560602, 20367798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	18560602		★★★★★ ★☆☆☆☆ Found in Text Mining only
	Behcet Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	20375120, 20622878, 20622879, 22197900, 22378604, 22483685, 23291587, 23633568, 24286189, 25156021, 25439430, 25940109, 26005883, 26068404, 26097239 View all (9 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	22378604, 22385240, 23633568, 24286189, 26222305, 27548383, 29017598, 33393726	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	ORPHANET_DG	23633568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	26785681	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24861772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23042301, 23239971, 29328397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17952073, 23239971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	23042301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22154103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25015728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29864461, 34190694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24861772, 30214568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	30355949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23250909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20082850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19317742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cavitary Optic Disc Anomalies	Cavitary optic disc anomalies	Pubtator	26626589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	18047540, 18368064, 19175939, 19455118		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	LHGDN	18368064, 19175939		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	18369459, 19175939	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	19175939, 26887945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21791252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	32267379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22089030, 25838550, 27780712, 29728642, 31158699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17484863, 17786191, 18698678, 19122664, 19175939, 21830272, 22022372, 22154103, 22269043, 22735800, 22984500, 24068945, 24382939, 24415875, 24971461 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18438406	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22154103, 25911397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21079743, 21830272, 23300620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25838550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21547355, 22154103, 24440568, 25015728, 25680555, 25838550, 25911397, 26083022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22154103, 25015728, 26083022, 36232773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	25911397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28041935, 28595093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25192515, 31074535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24699314, 25192515, 31074535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25192515, 31074535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25192515, 31074535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17068223, 17309073, 17447842, 17455206, 17484863, 17508420, 17534574, 17587057, 17606463, 17618837, 17786191, 17877509, 17894849, 17922230, 17993580 View all (87 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASDB_DG	17068223, 17435756, 17447842, 17554300, 17684544, 17804789, 18587394, 20570966, 21102463, 22293688, 22412388, 22936669, 23850713		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	17068223, 17309073, 17447842, 17484863, 17618837, 17786191, 17804789, 18073300, 18383363, 18438406, 18470928, 18521914, 18698678, 18715515, 19021011 View all (42 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	17309073, 17508420, 17804789, 17894849, 18022867, 18030204, 18470928, 18499543, 18698678, 19103559, 19175939		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	17435756, 17447842, 17554300, 17804789, 18587394, 20570966, 21102463, 22293688, 22412388, 22936669, 23850713, 26192919, 26301688, 26974007, 28067908, 30500874 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	17435756, 18438406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	19273624, 24382939	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	21983784	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	27893410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	27893410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28855314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25223230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	26887945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37123139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18045485, 23579029, 26887945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24957500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	23239971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	30459442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	31123953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25223230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	30506912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21484795, 31197899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21484795, 31197899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24586528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	28682143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28102292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	21151597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	26151690, 33402994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	31197899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21285166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34412691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	26399911, 31738005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	23792271	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	29142307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	18209723, 19896081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	18073300, 19021011, 20016049, 22663548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	18073300, 19021011	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	18073300, 19021011, 22663548	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	18499543, 20066736, 24382939, 25858864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	20016049, 24460100, 25863684, 26228217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	26228217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23393581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	23393581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	34190694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25192515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	19918037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19918037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	25329069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic achalasia of esophagus	Idiopathic achalasia	BEFREE	20367798		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	20978829		★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	23696856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24332578, 26846416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	23564312, 26859125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 17	Inflammatory Bowel Disease	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Inflammatory Bowel Disease 5	Inflammatory bowel disease	Pubtator	22440928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17068223, 17309073, 17484863, 17508420, 17618837, 17628615, 17661912, 17678723, 17678845, 17786191, 17877509, 17894849, 18047540, 18088064, 18164077 View all (55 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	17068223, 18758464, 23128233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17068223, 17309073, 17484863, 17618837, 17786191, 18383363, 18698678, 19103525, 19165485, 19175939, 19877036, 19918037, 20066736, 21088407, 21151126 View all (24 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17508420, 17894849, 18383363, 18383521, 18698678		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	18758464, 23128233, 28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	21983784, 23291587, 26192919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21983784, 27458846	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory dermatosis	Dermatitis	BEFREE	28855314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	29142307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	21547355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17309073, 18341487, 19175939, 31615448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	21281511, 26016922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	BEFREE	21281511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis Ichthyosis Deafness Syndrome	Keratitis ichthyosis deafness syndrome	Pubtator	30150638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	30355949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	22019778, 23240095, 25044438		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	CTD_human_DG	22019778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	Pubtator	28842327	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23393581, 24793548, 26191290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20622911, 23393581, 26191290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21717520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22735941, 23807368, 25666505, 28452232, 29864461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	24375552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	22695161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30641535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	27320770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31166866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21110900	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27320770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31166866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17661912, 19306001, 19757086, 19895338, 23754344, 27320770, 28646040, 31166866, 31477400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31166866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22173670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25015728	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23042301, 23239971, 29328397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21484795, 31197899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	30355949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23250909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21717520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	23042301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20082850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20607725, 20863779, 25666505, 29574157, 30831443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24861772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20082850, 21484795, 21547355, 23042301, 24586528, 24861772, 25680555, 26083022, 26717375, 29664967, 29921599, 30483821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22154103, 25911397		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22772464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28786198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	17952073, 22182694, 27893410, 33037101	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18082575, 18164077, 18368064, 22182694, 24547735, 26000455, 27893410, 28593439		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18368064		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	18180107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17901940, 30459442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23042301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	28224332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28224332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20671120, 21547355, 21717520, 24440568, 25911397, 29328397, 30355949		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Crohn disease	Crohn disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Ulcerative colitis	Ulcerative colitis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21412764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20082850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32884248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	33340282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	30116153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	23137879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	22440928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17205061, 17587057, 17661912, 18219280, 18369459, 18383363, 18614543, 18647855, 18650833, 18800148, 18923449, 19035472, 19040306, 19175939, 19189980 View all (37 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	17236132, 17587057, 18034172, 18219280, 18383363, 18650833, 19169254, 19175939		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	18369459, 18383363, 18614543, 18800148, 19035472, 19169254, 19175939, 19877036, 21364948, 21846945, 22022372, 22298274, 23750651, 24286492, 26887945, 38301504 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19169254, 20953190, 24212883		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	19169254, 20953190, 25574825, 25903422, 26301688, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASDB_DG	19169254, 20953187, 20953190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	18800148, 20084005, 25406098, 29454820		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19169254, 20953190, 24212883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22154103, 25911397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	22154103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retrobulbar Neuritis	Retrobulbar Neuritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	29985710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17606463, 17678723, 18073300, 18647855, 19021011, 19034457, 22130325, 22718508, 23053963, 23054009, 25387578, 25858864, 26016922, 28547498, 29370888 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17606463		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	23696856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	23818276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	Pubtator	23818276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	18369459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	20650992, 21846945, 26051272, 27306066	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	21846945		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	17606463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	19536281, 19918037, 30641535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31658288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23274341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23250909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	20193000, 23818276, 26068404, 30646942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	17952073, 18383363, 19522770, 19877036, 20062062, 20463747, 21248258, 21364948, 21846945, 22144400, 23606107, 23818276, 23840727, 24998354, 26916345, 28381868, 30646942, 40349828 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	39185422	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	23239971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24586528, 30483821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23250909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20607725, 20863779, 25666505, 29574157, 30831443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29118466, 30833806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	31778214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis Syndrome	Synovitis, Acne, Pustulosis, Hyperostosis, and Osteitis (SAPHO) Syndrome	BEFREE	31701644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17606463, 18713787, 19918037		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Takayasu Arteritis	Takayasu Arteritis	BEFREE	26987707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29864461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	18073300, 19021011, 26578206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	LHGDN	19021011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	19021011, 35767887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	24861772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	30459442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17068223, 17455206, 17484863, 17508420, 17786191, 17877509, 17894849, 18047540, 18088064, 18338763, 18383521, 18438406, 18500230, 19175939, 19276991 View all (33 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	17484863, 19122664, 19175939		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	18438406, 19122664, 20228799		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	19122664, 19915572, 20228799, 21297633, 26192919, 26301688, 26398853, 26974007, 28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASDB_DG	19122664, 19915572, 20228799, 21297633		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	BEFREE	21846945, 23840727, 28558665, 31669406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	21846945, 23840727	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis Anterior	Anterior uveitis	Pubtator	24312163, 25200001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	20116410, 25108386, 25439430, 26628628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	GWASCAT_DG	25108386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	32437414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

IL23R (interleukin 23 receptor)