CTF1 (cardiotrophin 1)

Gene

• Entrez ID: 1489
• Gene name: Cardiotrophin 1
• Gene symbol: CTF1
• Synonyms (NCBI Gene): CT-1, CT1
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT914603	hsa-miR-1178	CLIP-seq
MIRT914604	hsa-miR-1273	CLIP-seq
MIRT914605	hsa-miR-1273f	CLIP-seq
MIRT914606	hsa-miR-1285	CLIP-seq
MIRT914607	hsa-miR-1324	CLIP-seq
MIRT914608	hsa-miR-143	CLIP-seq
MIRT914609	hsa-miR-2110	CLIP-seq
MIRT914610	hsa-miR-2114	CLIP-seq
MIRT914611	hsa-miR-2278	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT914614	hsa-miR-3166	CLIP-seq
MIRT914615	hsa-miR-3187-5p	CLIP-seq
MIRT914616	hsa-miR-3197	CLIP-seq
MIRT914617	hsa-miR-342-3p	CLIP-seq
MIRT914618	hsa-miR-3714	CLIP-seq
MIRT914619	hsa-miR-377	CLIP-seq
MIRT914620	hsa-miR-3918	CLIP-seq
MIRT914621	hsa-miR-4271	CLIP-seq
MIRT914622	hsa-miR-4468	CLIP-seq
MIRT914623	hsa-miR-4486	CLIP-seq
MIRT914624	hsa-miR-4643	CLIP-seq
MIRT914625	hsa-miR-4649-3p	CLIP-seq
MIRT914626	hsa-miR-4649-5p	CLIP-seq
MIRT914627	hsa-miR-466	CLIP-seq
MIRT914628	hsa-miR-4667-5p	CLIP-seq
MIRT914629	hsa-miR-4700-5p	CLIP-seq
MIRT914630	hsa-miR-4708-5p	CLIP-seq
MIRT914631	hsa-miR-4725-3p	CLIP-seq
MIRT914632	hsa-miR-4725-5p	CLIP-seq
MIRT914633	hsa-miR-4731-5p	CLIP-seq
MIRT914634	hsa-miR-4770	CLIP-seq
MIRT914635	hsa-miR-4789-3p	CLIP-seq
MIRT914636	hsa-miR-504	CLIP-seq
MIRT914637	hsa-miR-597	CLIP-seq
MIRT914638	hsa-miR-612	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914640	hsa-miR-940	CLIP-seq
MIRT914641	hsa-miR-1225-3p	CLIP-seq
MIRT914642	hsa-miR-1233	CLIP-seq
MIRT914643	hsa-miR-1304	CLIP-seq
MIRT914607	hsa-miR-1324	CLIP-seq
MIRT914644	hsa-miR-1827	CLIP-seq
MIRT914645	hsa-miR-2277-3p	CLIP-seq
MIRT914646	hsa-miR-2467-5p	CLIP-seq
MIRT914647	hsa-miR-2682	CLIP-seq
MIRT914614	hsa-miR-3166	CLIP-seq
MIRT914648	hsa-miR-3188	CLIP-seq
MIRT914649	hsa-miR-3192	CLIP-seq
MIRT914650	hsa-miR-34a	CLIP-seq
MIRT914651	hsa-miR-34c-5p	CLIP-seq
MIRT914652	hsa-miR-3612	CLIP-seq
MIRT914653	hsa-miR-3689a-3p	CLIP-seq
MIRT914654	hsa-miR-3689c	CLIP-seq
MIRT914655	hsa-miR-3689d	CLIP-seq
MIRT914656	hsa-miR-3944-5p	CLIP-seq
MIRT914657	hsa-miR-3975	CLIP-seq
MIRT914658	hsa-miR-4459	CLIP-seq
MIRT914622	hsa-miR-4468	CLIP-seq
MIRT914659	hsa-miR-449a	CLIP-seq
MIRT914660	hsa-miR-449b	CLIP-seq
MIRT914661	hsa-miR-449c	CLIP-seq
MIRT914662	hsa-miR-4728-5p	CLIP-seq
MIRT914633	hsa-miR-4731-5p	CLIP-seq
MIRT914663	hsa-miR-485-5p	CLIP-seq
MIRT914664	hsa-miR-512-3p	CLIP-seq
MIRT914665	hsa-miR-650	CLIP-seq
MIRT914666	hsa-miR-665	CLIP-seq
MIRT1971354	hsa-miR-3130-3p	CLIP-seq
MIRT1971355	hsa-miR-4252	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914641	hsa-miR-1225-3p	CLIP-seq
MIRT914642	hsa-miR-1233	CLIP-seq
MIRT914604	hsa-miR-1273	CLIP-seq
MIRT1971354	hsa-miR-3130-3p	CLIP-seq
MIRT1971355	hsa-miR-4252	CLIP-seq
MIRT914623	hsa-miR-4486	CLIP-seq
MIRT914626	hsa-miR-4649-5p	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914606	hsa-miR-1285	CLIP-seq
MIRT914615	hsa-miR-3187-5p	CLIP-seq
MIRT914638	hsa-miR-612	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT2510188	hsa-miR-1283	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT2510189	hsa-miR-3613-3p	CLIP-seq
MIRT2510190	hsa-miR-4684-5p	CLIP-seq
MIRT2510188	hsa-miR-1283	CLIP-seq
MIRT914606	hsa-miR-1285	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT914615	hsa-miR-3187-5p	CLIP-seq
MIRT2510189	hsa-miR-3613-3p	CLIP-seq
MIRT2510190	hsa-miR-4684-5p	CLIP-seq
MIRT914638	hsa-miR-612	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005146	Function	Leukemia inhibitory factor receptor binding	TAS	8833032
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	7862649
GO:0005615	Component	Extracellular space	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007267	Process	Cell-cell signaling	TAS	7862649
GO:0007399	Process	Nervous system development	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0007517	Process	Muscle organ development	TAS	7862649, 8833032
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7862649
GO:0030182	Process	Neuron differentiation	TAS	7738033
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	21912637
GO:0048666	Process	Neuron development	IEA

Other IDs

• MIM: 600435
• HGNC: 2499
• e!Ensembl: ENSG00000150281

Protein

• UniProt ID: Q16619
• Protein name: Cardiotrophin-1 (CT-1)
• Protein function: Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes
• Sequence:

  MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
  FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
  RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
  YREWLSRTEGDLGQLLPGGSA

• Sequence length: 201

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway

Reactome:

IL-6-type cytokine receptor ligand interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CTF1-related disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dilated Cardiomyopathy, Dominant	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic cardiomyopathy	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE MYOCLONIC EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary dilated cardiomyopathy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary familial hypertrophic cardiomyopathy	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	11358482, 11555629		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24041953, 28330662		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18055523, 23935888	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24041953, 28330662		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	25732979	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	16920889	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19059413, 28721158		★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	25919795		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30589223		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29572384, 30341227, 31805674		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10618298, 12234945, 17637508, 17885560, 20224758, 24366078, 26084457, 30408810, 30612490		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28207527		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25025664		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25025664		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25025664	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23776558	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	20683337		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	33813485	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24362075		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25919795		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	21771897		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12234945, 17885560, 24366078, 26084457, 30612490		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	12234945		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	17885560	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	23041742, 33813485	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	28785017		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	25732979	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	21803294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	17885560	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20683337		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	33813485	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	33813485	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37858084	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28285145		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30341227		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25025664	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	GWASCAT_DG	30531953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	23335628		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	10618298, 17885560, 20683337, 22418690		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24289128		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17940213		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	17940213		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	33813485	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	11358482, 12645079, 23541490		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	23776558	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24362075		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	21803294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	24362075, 28298172, 28809783		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29600728		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30589223		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	23541490		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	12761038		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24362075, 28231848		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29572384, 30341227, 31805674		★☆☆☆☆ Found in Text Mining only