Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	148753
Gene name	Family with sequence similarity 163 member A
Gene symbol	FAM163A
Synonyms (NCBI Gene)	C1orf76NDSP
Chromosome	1
Chromosome location	1q25.2

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT718035	hsa-miR-4685-5p	HITS-CLIP	19536157
MIRT718034	hsa-miR-6837-5p	HITS-CLIP	19536157
MIRT718033	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT718032	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT718031	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT718030	hsa-miR-4527	HITS-CLIP	19536157
MIRT718029	hsa-miR-6503-5p	HITS-CLIP	19536157
MIRT718028	hsa-miR-513c-5p	HITS-CLIP	19536157
MIRT718027	hsa-miR-514b-5p	HITS-CLIP	19536157
MIRT646905	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT646904	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT646903	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT646902	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT646901	hsa-miR-4783-5p	HITS-CLIP	23824327
MIRT646900	hsa-miR-933	HITS-CLIP	23824327
MIRT646899	hsa-miR-4711-3p	HITS-CLIP	23824327
MIRT646898	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT646897	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT441981	hsa-miR-1273g-3p	PAR-CLIP	22100165
MIRT441980	hsa-miR-658	PAR-CLIP	22100165
MIRT646897	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT646898	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT718035	hsa-miR-4685-5p	HITS-CLIP	19536157
MIRT718034	hsa-miR-6837-5p	HITS-CLIP	19536157
MIRT718033	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT718032	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT718031	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT718030	hsa-miR-4527	HITS-CLIP	19536157
MIRT718029	hsa-miR-6503-5p	HITS-CLIP	19536157
MIRT718028	hsa-miR-513c-5p	HITS-CLIP	19536157
MIRT718027	hsa-miR-514b-5p	HITS-CLIP	19536157
MIRT646905	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT646904	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT646903	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT646902	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT646901	hsa-miR-4783-5p	HITS-CLIP	23824327
MIRT646900	hsa-miR-933	HITS-CLIP	23824327
MIRT646899	hsa-miR-4711-3p	HITS-CLIP	23824327
MIRT646898	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT646897	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT441981	hsa-miR-1273g-3p	PAR-CLIP	22100165
MIRT441980	hsa-miR-658	PAR-CLIP	22100165
MIRT981513	hsa-miR-134	CLIP-seq
MIRT981514	hsa-miR-3118	CLIP-seq
MIRT981515	hsa-miR-3606	CLIP-seq
MIRT981516	hsa-miR-3650	CLIP-seq
MIRT981517	hsa-miR-4302	CLIP-seq
MIRT981518	hsa-miR-4436b-3p	CLIP-seq
MIRT981519	hsa-miR-4455	CLIP-seq
MIRT981520	hsa-miR-4519	CLIP-seq
MIRT981521	hsa-miR-4756-3p	CLIP-seq
MIRT981522	hsa-miR-609	CLIP-seq
MIRT981523	hsa-miR-921	CLIP-seq
MIRT1990781	hsa-miR-1184	CLIP-seq
MIRT2225015	hsa-miR-1207-3p	CLIP-seq
MIRT2225016	hsa-miR-4675	CLIP-seq
MIRT2225017	hsa-miR-4741	CLIP-seq

Show/Hide all (2)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
611727	28274	ENSG00000143340

Q96GL9

Protein name

Protein FAM163A (Cebelin) (Neuroblastoma-derived secretory protein)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15069	FAM163	1 → 167	FAM163 family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in neuroblastoma compared to other tissues, suggesting that it may be used as a marker for metastasis in bone marrow. {ECO:0000269|PubMed:17208556}.

Sequence

MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKSGTEVADEEEEREHDLPTHPRGP
TCNACSSQALDGRGSLAPLTSEPCSQPCGVAASHCTTCSPYSSPFYIRTADMVPNGGGGE
RLSFAPTYYKEGGPPSLKLAAPQSYPVTWPGSGREAFTNPRAISTDV

Sequence length

167

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LANGUAGE IMPAIRMENT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Borderline Personality Disorder	Borderline personality disorder	Pubtator	25612291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	25612291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19671756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31496741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19671756, 31496741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19671756	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31496741		★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM163A (family with sequence similarity 163 member A)