SLC35F3 (solute carrier family 35 member F3)

Gene

• Entrez ID: 148641
• Gene name: Solute carrier family 35 member F3
• Gene symbol: SLC35F3
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q42.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022707	hsa-miR-124-3p	Microarray	18668037
MIRT024794	hsa-miR-215-5p	Microarray	19074876
MIRT026593	hsa-miR-192-5p	Microarray	19074876
MIRT1361757	hsa-miR-3652	CLIP-seq
MIRT1361758	hsa-miR-3976	CLIP-seq
MIRT1361759	hsa-miR-4430	CLIP-seq
MIRT1361760	hsa-miR-4505	CLIP-seq
MIRT1361761	hsa-miR-4643	CLIP-seq
MIRT1361762	hsa-miR-466	CLIP-seq
MIRT1361763	hsa-miR-4672	CLIP-seq
MIRT1361764	hsa-miR-4789-3p	CLIP-seq
MIRT2107162	hsa-miR-1206	CLIP-seq
MIRT2691158	hsa-miR-1470	CLIP-seq
MIRT2691159	hsa-miR-3667-3p	CLIP-seq
MIRT2691160	hsa-miR-4667-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0015888	Process	Thiamine transport	IBA
GO:0015888	Process	Thiamine transport	IDA	24509276
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8IY50
• Protein name: Solute carrier family 35 member F3 (Thiamine transporter SLC35F3)
• Protein function: Mediates thiamine transport.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00892	EamA	67 → 223	EamA-like transporter family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at the highest levels in the adult cerebellum. {ECO:0000269|PubMed:19252338}.
• Sequence:

  MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSR
  AQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHV
  CKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDV
  SVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVA
  SASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDI
  PWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVI
  AIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFA
  R

• Sequence length: 421

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40302342	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30940143		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33858496	Associate	★☆☆☆☆ Found in Text Mining only
Diverticular Bleeding	Diverticular Bleeding	CTD_human_DG	30177863		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	30177863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticular Diseases	Diverticular Diseases	CTD_human_DG	30177863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	24509276	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24509276	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	24509276		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	GWASCAT_DG	29531279		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	36678339	Associate	★☆☆☆☆ Found in Text Mining only
Thiamine Deficiency	Thiamine Deficiency	BEFREE	24509276		★☆☆☆☆ Found in Text Mining only
Thiamine Deficiency	Thiamine deficiency	Pubtator	24509276	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37733241	Associate	★☆☆☆☆ Found in Text Mining only