ZNF569 (zinc finger protein 569)

Gene

• Entrez ID: 148266
• Gene name: Zinc finger protein 569
• Gene symbol: ZNF569
• Synonyms (NCBI Gene): ZAP1, ZNF, Zfp74
• Chromosome: 19
• Chromosome location: 19q13.12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1530178	hsa-miR-1245	CLIP-seq
MIRT1530179	hsa-miR-1299	CLIP-seq
MIRT1530180	hsa-miR-3168	CLIP-seq
MIRT1530181	hsa-miR-3177-5p	CLIP-seq
MIRT1530182	hsa-miR-3664-5p	CLIP-seq
MIRT1530183	hsa-miR-3675-3p	CLIP-seq
MIRT1530184	hsa-miR-4265	CLIP-seq
MIRT1530185	hsa-miR-4296	CLIP-seq
MIRT1530186	hsa-miR-4322	CLIP-seq
MIRT1530187	hsa-miR-4714-5p	CLIP-seq
MIRT1530188	hsa-miR-4753-3p	CLIP-seq
MIRT1530189	hsa-miR-599	CLIP-seq
MIRT1530190	hsa-miR-875-3p	CLIP-seq
MIRT2160291	hsa-miR-3200-3p	CLIP-seq
MIRT2379613	hsa-miR-125a-3p	CLIP-seq
MIRT2379614	hsa-miR-1305	CLIP-seq
MIRT2379615	hsa-miR-2113	CLIP-seq
MIRT2379616	hsa-miR-2116	CLIP-seq
MIRT2379617	hsa-miR-3686	CLIP-seq
MIRT2379618	hsa-miR-3934	CLIP-seq
MIRT2379619	hsa-miR-3942-3p	CLIP-seq
MIRT2379620	hsa-miR-421	CLIP-seq
MIRT2379621	hsa-miR-4677-5p	CLIP-seq
MIRT2379622	hsa-miR-4742-3p	CLIP-seq
MIRT2379623	hsa-miR-4778-5p	CLIP-seq
MIRT2379624	hsa-miR-550a	CLIP-seq
MIRT2379625	hsa-miR-764	CLIP-seq
MIRT2379615	hsa-miR-2113	CLIP-seq
MIRT2441853	hsa-miR-3121-5p	CLIP-seq
MIRT2441854	hsa-miR-4318	CLIP-seq
MIRT2441855	hsa-miR-4326	CLIP-seq
MIRT2441856	hsa-miR-4693-5p	CLIP-seq
MIRT2441857	hsa-miR-892a	CLIP-seq
MIRT2671612	hsa-miR-409-3p	CLIP-seq
MIRT2671613	hsa-miR-4684-5p	CLIP-seq
MIRT2671614	hsa-miR-7	CLIP-seq
MIRT2671612	hsa-miR-409-3p	CLIP-seq
MIRT2671613	hsa-miR-4684-5p	CLIP-seq
MIRT2671614	hsa-miR-7	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 613904
• HGNC: 24737
• e!Ensembl: ENSG00000196437

Protein

• UniProt ID: Q5MCW4
• Protein name: Zinc finger protein 569
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01352	KRAB	7 → 48	KRAB box	Family
  PF00096	zf-C2H2	186 → 208	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	214 → 236	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	242 → 264	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	270 → 292	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	298 → 320	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	326 → 348	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	354 → 376	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	382 → 404	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	410 → 432	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	438 → 460	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	466 → 488	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	494 → 516	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	522 → 544	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	550 → 572	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	578 → 600	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	606 → 628	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	634 → 656	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	662 → 684	Zinc finger, C2H2 type	Domain

• Sequence:

  MTESQGTVTFKDVAIDFTQEEWKRLDPAQRKLYRNVMLENYNNLITVGYPFTKPDVIFKL
  EQEEEPWVMEEEVLRRHWQGEIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFA
  NVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSH
  FVITPFKCNHCGKGFNQTLDLIRHLRIHTGEKPYECSNCRKAFSHKEKLIKHYKIHSREQ
  SYKCNECGKAFIKMSNLIRHQRIHTGEKPYACKECEKSFSQKSNLIDHEKIHTGEKPYEC
  NECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCG
  KAFSQFSMLIIHVRIHTGEKPYECNECGKAFSQSSALTVHMRSHTGEKPYECKECRKAFS
  HKKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSN
  LIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLH
  LRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGH
  TGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEK
  PYHCIECGKAFSQKSHLVRHQRIHTH

• Sequence length: 686

Pathways

Reactome:

Generic Transcription Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31847356		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27928708, 30157956, 30315897, 31067307		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29084829, 31453726		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	29084829	Associate	★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	7557990		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25421577		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	30466473		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	21278247		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	21278247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	6823012		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28582864		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36670548	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30315897		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	30896577		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	31453726		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19671739, 23372733, 24124608		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29875246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25421577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30444046		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27655485, 28670441, 29370947, 30444046		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31165610		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30444046, 31165610, 31258729		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30315897		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31543366		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	28616777		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31258729		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29844130	Associate	★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	7557990		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	16793369		★☆☆☆☆ Found in Text Mining only