Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	147906
Gene name	Dishevelled binding antagonist of beta catenin 3
Gene symbol	DACT3
Synonyms (NCBI Gene)	DAPPER3RRR1
Chromosome	19
Chromosome location	19q13.32

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005875	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005875	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005875	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005875	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005875	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT731470	hsa-miR-638	Luciferase reporter assayqRT-PCRWestern blot	28108314
MIRT731470	hsa-miR-638	Luciferase reporter assayqRT-PCRWestern blot	28108314
MIRT731470	hsa-miR-638	Luciferase reporter assayqRT-PCRWestern blot	28108314
MIRT731470	hsa-miR-638	Luciferase reporter assayqRT-PCRWestern blot	28108314
MIRT756101	hsa-miR-9-5p	Luciferase reporter assayWestern blottingqRT-PCR	35598381
MIRT922683	hsa-miR-101	CLIP-seq
MIRT922684	hsa-miR-1183	CLIP-seq
MIRT922685	hsa-miR-1245b-3p	CLIP-seq
MIRT922686	hsa-miR-144	CLIP-seq
MIRT922687	hsa-miR-3121-5p	CLIP-seq
MIRT922688	hsa-miR-3126-3p	CLIP-seq
MIRT922689	hsa-miR-3150a-3p	CLIP-seq
MIRT922690	hsa-miR-3175	CLIP-seq
MIRT922691	hsa-miR-3176	CLIP-seq
MIRT922692	hsa-miR-3609	CLIP-seq
MIRT922693	hsa-miR-3915	CLIP-seq
MIRT922694	hsa-miR-3922-3p	CLIP-seq
MIRT922695	hsa-miR-3928	CLIP-seq
MIRT922696	hsa-miR-4667-5p	CLIP-seq
MIRT922697	hsa-miR-4700-5p	CLIP-seq
MIRT922698	hsa-miR-4775	CLIP-seq
MIRT922699	hsa-miR-4799-5p	CLIP-seq
MIRT922700	hsa-miR-495	CLIP-seq
MIRT922701	hsa-miR-548ah	CLIP-seq
MIRT922702	hsa-miR-590-3p	CLIP-seq
MIRT922703	hsa-miR-645	CLIP-seq
MIRT922704	hsa-miR-939	CLIP-seq
MIRT1973323	hsa-miR-1184	CLIP-seq
MIRT1973324	hsa-miR-1205	CLIP-seq
MIRT1973325	hsa-miR-1909	CLIP-seq
MIRT1973326	hsa-miR-3158-5p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
EZH2	Repression	22144423
NKX2-5	Repression	19479054

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	18538736
GO:0030308	Process	Negative regulation of cell growth	IDA	18538736
GO:0042802	Function	Identical protein binding	IEA
GO:0051018	Function	Protein kinase A binding	IEA
GO:0051018	Function	Protein kinase A binding	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0070097	Function	Delta-catenin binding	IEA
GO:0070097	Function	Delta-catenin binding	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	18538736
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA

MIM	HGNC	e!Ensembl
611112	30745	ENSG00000197380

Q96B18

Protein name

Dapper homolog 3 (Antagonist of beta-catenin Dapper homolog 3) (Arginine-rich region 1 protein) (Dapper antagonist of catenin 3)

Protein function

May be involved in regulation of intracellular signaling pathways during development. Specifically thought to play a role in canonical and/or non-canonical Wnt signaling pathways through interaction with DSH (Dishevelled) family proteins. {ECO:0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15268	Dapper	19 → 166	Dapper	Family
PF15268	Dapper	543 → 629	Dapper	Family

Sequence

MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDE
EDADEDEDAAAARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYED
PSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEPRGIYASERPKSLGDASPSAPEVVGAR
AAVPRSFSAPYPTAGGSAGPEACSSAERRARAGPFLTPSPLHAVAMRSPRPCGRPPTDSP
DAGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPRRQNSVRQRPPDASPSPGSAR
PAREPSLERVGGHPTSPAALSRAWASSWESEAAPEPAAPPAAPSPPDSPAEGRLVKAQYI
PGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARK
ASRSQSETSLLGRASAVPSGPPKYPTAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTA
EIDAADGRRVRPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGG
VGGGYGESESSASEGESPAFSSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAK
VFVKIKASHALKKKILRFRSGSLKVMTTV

Sequence length

629

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive spastic paraparesis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	29456669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24809775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35764883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18538736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18538736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18538736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28077137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28077137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28077137	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35764883	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21048943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28077137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28108314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21642358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	39341975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DACT3 (dishevelled binding antagonist of beta catenin 3)