Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	147700
Gene name	Kinesin light chain 3
Gene symbol	KLC3
Synonyms (NCBI Gene)	KLC2KLC2LKLCtKNS2B
Chromosome	19
Chromosome location	19q13.32
Summary	This gene encodes a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT723632	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT723631	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT723630	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT723629	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT723632	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT723631	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT723630	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT723629	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT2025703	hsa-miR-1226	CLIP-seq
MIRT2025704	hsa-miR-4690-3p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15161933, 25416956, 26871637, 28514442, 31515488, 32296183, 32814053, 33961781, 35271311, 36931259, 39251607
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	ISS
GO:0008017	Function	Microtubule binding	IEA
GO:0008088	Process	Axo-dendritic transport	IEA
GO:0019894	Function	Kinesin binding	IBA
GO:0019894	Function	Kinesin binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0035253	Component	Ciliary rootlet	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0120317	Process	Sperm mitochondrial sheath assembly	IEA
GO:0120317	Process	Sperm mitochondrial sheath assembly	ISS

MIM	HGNC	e!Ensembl
601334	20717	ENSG00000104892

Q6P597

Protein name

Kinesin light chain 3 (KLC2-like) (kinesin light chain 2)

Protein function

Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. Plays a role during spermiogenesis in the development of the sperm tail midpiece and in the normal function of spermatozoa (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Type
PF13424	TPR_12	205 → 281	Repeat
PF13424	TPR_12	247 → 323	Repeat
PF13424	TPR_12	331 → 402	Repeat

Sequence

MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAG
LEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLR
EELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPS
EEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERS
SGHCHPDVATMLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFEDVERHYARAL
SIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAG
DAEQALRRSSSLSKIRESIRRGSEKLVSRLRGEAAAGAAGMKRAMSLNTLNVDAPRAPGT
QFPSWHLDKAPRTLSASTQDLSPH

Sequence length

504

Interactions

View interactions

	KEGG		Reactome
	Motor proteins Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Salmonella infection		MHC class II antigen presentation RHO GTPases activate KTN1 COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
XERODERMA PIGMENTOSUM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP D	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35563834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26130668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal amyotrophy	Distal amyotrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal lower limb amyotrophy	Distal lower limb amyotrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24634177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gross motor development delay	Developmental delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37055376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	35902954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	26385635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25668010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26124010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral axonal neuropathy	Peripheral axonal neuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Optic Atrophy, and Neuropathy	Spastic Paraplegia, Optic Atrophy, And Neuropathy	BEFREE	26385635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Optic Atrophy, and Neuropathy	Spastic Paraplegia, Optic Atrophy, And Neuropathy	GENOMICS_ENGLAND_DG	26385635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Optic Atrophy, and Neuropathy	Spastic Paraplegia, Optic Atrophy, And Neuropathy	ORPHANET_DG	26385635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Optic Atrophy, and Neuropathy	Spastic Paraplegia, Optic Atrophy, And Neuropathy	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Optic Atrophy, and Neuropathy	Spastic Paraplegia, Optic Atrophy, And Neuropathy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia-optic atrophy-neuropathy syndrome	Spastic Paraplegia, Optic Atrophy, And Neuropathy	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26130668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KLC3 (kinesin light chain 3)