Gene Gene information from NCBI Gene database.
Entrez ID 1477
Gene name Cleavage stimulation factor subunit 1
Gene symbol CSTF1
Synonyms (NCBI Gene)
CstF-50CstFp50
Chromosome 20
Chromosome location 20q13.2-q13.31
Summary This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3`end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like
miRNA miRNA information provided by mirtarbase database.
417
miRTarBase ID miRNA Experiments Reference
MIRT016180 hsa-miR-590-3p Sequencing 20371350
MIRT715290 hsa-miR-499a-3p HITS-CLIP 19536157
MIRT715289 hsa-miR-499b-3p HITS-CLIP 19536157
MIRT715288 hsa-miR-3692-3p HITS-CLIP 19536157
MIRT680486 hsa-miR-5582-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 10477523, 21903422, 26030138, 33961781, 34524948
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600369 2483 ENSG00000101138
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q05048
Protein name Cleavage stimulation factor subunit 1 (CF-1 50 kDa subunit) (Cleavage stimulation factor 50 kDa subunit) (CSTF 50 kDa subunit) (CstF-50)
Protein function One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs (PubMed:10669729). May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA (PubMed:10669729).
PDB 6B3X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16699 CSTF1_dimer 7 62 Cleavage stimulation factor subunit 1, dimerisation domain Domain
PF00400 WD40 98 136 WD domain, G-beta repeat Repeat
PF00400 WD40 164 201 WD domain, G-beta repeat Repeat
PF00400 WD40 249 290 WD domain, G-beta repeat Repeat
PF00400 WD40 294 334 WD domain, G-beta repeat Repeat
PF00400 WD40 388 424 WD domain, G-beta repeat Repeat
Sequence
MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMEN
DD
TAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDG
QLIATGSADASIKILD
TERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLA
FHPTEQILASGSRDYTLKLFD
YSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPT
LRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTF
EKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWE
ISTGRTLVRYTGAGLSGRQVHRTQAV
FNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR
ARFW
YRRSTTD
Sequence length 431
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  mRNA surveillance pathway   mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Processing of Intronless Pre-mRNAs
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 25830658
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25830658 Associate
★☆☆☆☆
Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome Hereditary breast and ovarian cancer syndrome Pubtator 25830658 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 25830658
★☆☆☆☆
Found in Text Mining only