Gene Gene information from NCBI Gene database.
Entrez ID 147686
Gene name Zinc finger protein 418
Gene symbol ZNF418
Synonyms (NCBI Gene)
ZFP418
Chromosome 19
Chromosome location 19q13.43
miRNA miRNA information provided by mirtarbase database.
113
miRTarBase ID miRNA Experiments Reference
MIRT049908 hsa-miR-30a-3p CLASH 23622248
MIRT443933 hsa-miR-651-3p PAR-CLIP 22100165
MIRT443932 hsa-miR-3607-3p PAR-CLIP 22100165
MIRT443931 hsa-miR-3182 PAR-CLIP 22100165
MIRT443930 hsa-miR-5093 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001217 Function DNA-binding transcription repressor activity IDA 18084723
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619509 20647 ENSG00000196724
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TF45
Protein name Zinc finger protein 418
Protein function Transcriptional repressor (PubMed:18084723). May play a role as regulator of the ubiquitin-proteasome system and autophagy-lysosomal pathway (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 4 45 KRAB box Family
PF00096 zf-C2H2 230 252 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 258 280 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 286 308 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 314 336 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 342 364 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 370 392 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 398 420 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 426 448 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 454 476 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 482 504 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 510 532 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 538 560 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 591 613 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 619 641 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 647 669 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart. {ECO:0000269|PubMed:18084723}.
Sequence
MQGTVAFEDVAVNFSQEEWSLLSEVQRCLYHDVMLENWVLISSLGCWCGSEDEEAPSKKS
ISIQRVSQVSTPGAGVSPKKAHSCEMCGAILGDILHLADHQGTHHKQKLHRCEAWGNKLY
DSSNRPHQNQYLGEKPYRSSVEEALFVKRCKFHVSEESSIFIQSGKDFLPSSGLLLQEAT
HTGEKSNSKPECESPFQWGDTHYSCGECMKHSSTKHVFVQQQRLPSREECYCWECGKSFS
KYDSVSNHQRVH
TGKRPYECGECGKSFSHKGSLVQHQRVHTGKRPYECGECGKSFSHKGS
LVQHQRVH
TGERPYECGECGKSFSQNGTLIKHQRVHTGERPYECEECGKCFTQKGNLIQH
QRGH
TSERPYECEECGKCFSQKGTLTEHHRVHTRERPYECGECGKSFSRKGHLRNHQRGH
TGERPYECGECGKSFSRKGNLIQHQRSHTGERPYECRECRKLFRGKSHLIEHQRVHTGER
PYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYEC
GECGKSFHQSSSLLRHQKTH
TAERPYECRECGKFFSSLLEHRRVHTGERPYECRECGKTF
TRRSAHFKHQRLH
TRGKPYECSECGKSFAETFSLTEHRRVHTGERPYECSECGKSFHRSS
SLLRHQRVH
TERSPYK
Sequence length 676
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Moyamoya angiopathy Likely pathogenic rs2072226563 RCV004704500
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cardiomyopathy, Familial Idiopathic Cardiomyopathy BEFREE 29065170
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Esophageal squamous cell carcinoma Pubtator 29270239 Associate
★☆☆☆☆
Found in Text Mining only
Hypertrophic Cardiomyopathy Hypertrophic cardiomyopathy BEFREE 29065170
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 31337980
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 29785125
★☆☆☆☆
Found in Text Mining only
Stomach Carcinoma Stomach Carcinoma BEFREE 29785125
★☆☆☆☆
Found in Text Mining only