Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	147111
Gene name	Notum, palmitoleoyl-protein carboxylesterase
Gene symbol	NOTUM
Synonyms (NCBI Gene)	hNOTUM
Chromosome	17
Chromosome location	17q25.3

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030556	hsa-miR-24-3p	Microarray	19748357
MIRT1190203	hsa-miR-1207-5p	CLIP-seq
MIRT1190204	hsa-miR-3153	CLIP-seq
MIRT1190205	hsa-miR-3184	CLIP-seq
MIRT1190206	hsa-miR-3656	CLIP-seq
MIRT1190207	hsa-miR-423-5p	CLIP-seq
MIRT1190208	hsa-miR-4648	CLIP-seq
MIRT1190209	hsa-miR-4654	CLIP-seq
MIRT1190210	hsa-miR-4688	CLIP-seq
MIRT1190211	hsa-miR-4763-3p	CLIP-seq
MIRT1190212	hsa-miR-4769-5p	CLIP-seq
MIRT1190213	hsa-miR-486-3p	CLIP-seq
MIRT1190214	hsa-miR-885-3p	CLIP-seq
MIRT1190206	hsa-miR-3656	CLIP-seq
MIRT1190213	hsa-miR-486-3p	CLIP-seq
MIRT1190214	hsa-miR-885-3p	CLIP-seq
MIRT2284020	hsa-miR-34a	CLIP-seq
MIRT2284021	hsa-miR-34c-5p	CLIP-seq
MIRT2284022	hsa-miR-3616-3p	CLIP-seq
MIRT1190206	hsa-miR-3656	CLIP-seq
MIRT2284023	hsa-miR-4436b-3p	CLIP-seq
MIRT2284024	hsa-miR-4459	CLIP-seq
MIRT2284025	hsa-miR-449a	CLIP-seq
MIRT2284026	hsa-miR-449b	CLIP-seq
MIRT2284027	hsa-miR-4722-5p	CLIP-seq
MIRT2284028	hsa-miR-4779	CLIP-seq
MIRT1190213	hsa-miR-486-3p	CLIP-seq
MIRT1190214	hsa-miR-885-3p	CLIP-seq
MIRT1190206	hsa-miR-3656	CLIP-seq
MIRT1190213	hsa-miR-486-3p	CLIP-seq
MIRT1190214	hsa-miR-885-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TCF4	Activation	18429952

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004629	Function	Phospholipase C activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016298	Function	Lipase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	25731175
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030500	Process	Regulation of bone mineralization	IDA	30622831
GO:0030500	Process	Regulation of bone mineralization	IEA
GO:0030500	Process	Regulation of bone mineralization	IMP	30622831
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0060348	Process	Bone development	IEA
GO:0060348	Process	Bone development	IMP	30622831
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0140776	Function	Protein-containing complex destabilizing activity	IEA
GO:1990697	Process	Protein depalmitoleylation	IDA	25731175
GO:1990699	Function	Palmitoleyl hydrolase activity	IBA
GO:1990699	Function	Palmitoleyl hydrolase activity	IDA	25731175
GO:1990699	Function	Palmitoleyl hydrolase activity	IEA

MIM	HGNC	e!Ensembl
609847	27106	ENSG00000185269

Q6P988

Protein name

Palmitoleoyl-protein carboxylesterase NOTUM (EC 3.1.1.98) (hNOTUM)

Protein function

Carboxylesterase that acts as a key negative regulator of the Wnt signaling pathway by specifically mediating depalmitoleoylation of WNT proteins. Serine palmitoleoylation of WNT proteins is required for efficient binding to frizzled receptors (

PDB

4UYU , 4UYW , 4UYZ , 4UZ1 , 4UZ5 , 4UZ6 , 4UZ7 , 4UZ9 , 4UZA , 4UZL , 4UZQ , 4WBH , 6R8P , 6R8Q , 6R8R , 6T2H , 6T2K , 6TR5 , 6TR6 , 6TR7 , 6TUZ , 6TV4 , 6YSK , 6YUW , 6YUY , 6YV0 , 6YV2 , 6YV4 , 6YXI , 6ZUV , 6ZVL , 6ZYF , 7ARG , 7B2V , 7B2Y , 7B2Z , 7B37 , 7B3F , 7B3G , 7B3H , 7B3I , 7B3P , 7B3X , 7B45 , 7B4X , 7B50 , 7B7W , 7B7X , 7B7Y , 7B84 , 7B86

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03283	PAE	81 → 419	Pectinacetylesterase	Family

Tissue specificity

TISSUE SPECIFICITY: Rarely expressed in adult normal tissues. {ECO:0000269|PubMed:18429952}.

Sequence

MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVE
GNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRW
LLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFI
PYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLL
NVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNG
VVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGL
RLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHD
SHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQP
QGLEPSELLGMLSNGS

Sequence length

496

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Release of Hh-Np from the secreting cell Post-translational protein phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33667649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30343282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30343282, 33898197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	26926082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	26926082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18429952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18429952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30871618	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	26926082		★★★★★ ★☆☆☆☆ Found in Text Mining only

NOTUM (notum, palmitoleoyl-protein carboxylesterase)