Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	146909
Gene name	Kinesin family member 18B
Gene symbol	KIF18B
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q21.31

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049401	hsa-miR-92a-3p	CLASH	23622248
MIRT048234	hsa-miR-196a-5p	CLASH	23622248
MIRT672728	hsa-miR-5693	HITS-CLIP	23824327
MIRT672727	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT672726	hsa-miR-6089	HITS-CLIP	23824327
MIRT672725	hsa-miR-4284	HITS-CLIP	23824327
MIRT672724	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT672723	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT503265	hsa-miR-6165	PAR-CLIP	23446348
MIRT503264	hsa-miR-4690-5p	PAR-CLIP	23446348
MIRT503263	hsa-miR-6510-5p	PAR-CLIP	23446348
MIRT503262	hsa-miR-2392	PAR-CLIP	23446348
MIRT503261	hsa-miR-654-3p	PAR-CLIP	23446348
MIRT503260	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT503259	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT503258	hsa-miR-8089	PAR-CLIP	23446348
MIRT503257	hsa-miR-637	PAR-CLIP	23446348
MIRT503256	hsa-miR-7155-5p	PAR-CLIP	23446348
MIRT503255	hsa-miR-6804-5p	PAR-CLIP	23446348
MIRT503254	hsa-miR-3134	PAR-CLIP	23446348
MIRT503253	hsa-miR-4764-5p	PAR-CLIP	23446348
MIRT503252	hsa-miR-6869-5p	PAR-CLIP	23446348
MIRT503251	hsa-miR-1231	PAR-CLIP	23446348
MIRT496576	hsa-miR-1273g-3p	PAR-CLIP	22291592
MIRT496575	hsa-miR-4793-3p	PAR-CLIP	22291592
MIRT496574	hsa-miR-6788-3p	PAR-CLIP	22291592
MIRT496573	hsa-miR-6807-5p	PAR-CLIP	22291592
MIRT672728	hsa-miR-5693	HITS-CLIP	23824327
MIRT672727	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT672726	hsa-miR-6089	HITS-CLIP	23824327
MIRT672725	hsa-miR-4284	HITS-CLIP	23824327
MIRT672724	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT672723	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT503265	hsa-miR-6165	PAR-CLIP	23446348
MIRT503264	hsa-miR-4690-5p	PAR-CLIP	23446348
MIRT503263	hsa-miR-6510-5p	PAR-CLIP	23446348
MIRT503262	hsa-miR-2392	PAR-CLIP	23446348
MIRT503261	hsa-miR-654-3p	PAR-CLIP	23446348
MIRT503260	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT503259	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT503258	hsa-miR-8089	PAR-CLIP	23446348
MIRT503257	hsa-miR-637	PAR-CLIP	23446348
MIRT503256	hsa-miR-7155-5p	PAR-CLIP	23446348
MIRT503255	hsa-miR-6804-5p	PAR-CLIP	23446348
MIRT503254	hsa-miR-3134	PAR-CLIP	23446348
MIRT503253	hsa-miR-4764-5p	PAR-CLIP	23446348
MIRT503252	hsa-miR-6869-5p	PAR-CLIP	23446348
MIRT503251	hsa-miR-1231	PAR-CLIP	23446348
MIRT496576	hsa-miR-1273g-3p	PAR-CLIP	22291592
MIRT496575	hsa-miR-4793-3p	PAR-CLIP	22291592
MIRT496574	hsa-miR-6788-3p	PAR-CLIP	22291592
MIRT496573	hsa-miR-6807-5p	PAR-CLIP	22291592

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000235	Component	Astral microtubule	IDA	21820309
GO:0000278	Process	Mitotic cell cycle	IDA	20600703
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0003774	Function	Cytoskeletal motor activity	IDA	21820309
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005515	Function	Protein binding	IPI	21820309
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20600703
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20600703
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007019	Process	Microtubule depolymerization	IBA
GO:0007019	Process	Microtubule depolymerization	IDA	21820309
GO:0007019	Process	Microtubule depolymerization	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0019894	Function	Kinesin binding	IPI	21820309
GO:0035371	Component	Microtubule plus-end	IDA	21820309
GO:0051301	Process	Cell division	IEA
GO:0051302	Process	Regulation of cell division	IDA	20600703
GO:0061673	Component	Mitotic spindle astral microtubule	IBA
GO:1990023	Component	Mitotic spindle midzone	IBA
GO:1990752	Component	Microtubule end	IDA

MIM	HGNC	e!Ensembl
614570	27102	ENSG00000186185

Q86Y91

Protein name

Kinesin-like protein KIF18B

Protein function

In complex with KIF2C, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells. Its major role may be to transport KIF2C and/or MAPRE1 along microtubules.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	13 → 351	Kinesin motor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Shows a prominent expression in the amygdala. {ECO:0000269|PubMed:20600703}.

Sequence

MAVEDSTLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDG
PKKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTML
GREGDPGIMYLTTVELYRRLEARQQEKHFEVLISYQEVYNEQIHDLLEPKGPLAIREDPD
KGVVVQGLSFHQPASAEQLLEILTRGNRNRTQHPTDANATSSRSHAIFQIFVKQQDRVPG
LTQAVQVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKTH
VPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLSLKSNVT
SLDCHISQYATICQQLQAEVAALRKKLQVYEGGGQPPPQDLPGSPKSGPPPEHQPCTPEL
PAGPRALQEESLGMEAQVERAMEGNSSDQEQSPEDEDEGPAEEVPTQMPEQNPTHALPES
PRLTLQPKPVVGHFSARELDGDRSKQLALKVLCVAQRQYSLLQAANLLTPDMITEFETLQ
QLVQEEKIEPGAEALRTSGLARGAPLAQELCSESIPVPSPLCPEPPGYTGPVTRTMARRL
SGPLHTLGIPPGPNCTPAQGSRWPMEKKRRRPSALEADSPMAPKRGTKRQRQSFLPCLRR
GSLPDTQPSQGPSTPKGERASSPCHSPRVCPATVIKSRVPLGPSAMQNCSTPLALPTRDL
NATFDLSEEPPSKPSFHECIGWDKIPQELSRLDQPFIPRAPVPLFTMKGPKPTSSLPGTS
ACKKKRVASSSVSHGRSRIARLPSSTLKRPAGPLVLPELPLSPLCPSNRRNGKDLIRVGR
ALSAGNGVTKVS

Sequence length

852

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31759406, 31807007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	32963334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31758680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25236463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25236463, 31011256, 34112092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31489573	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31746384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36499051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31489573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31617652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36085568	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36085568	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25652157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25236463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29636620, 31489573, 31617652, 31807007		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31617652		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37744335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25236463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32963334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32587775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38049827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32228488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35137670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32766313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KIF18B (kinesin family member 18B)