SLC47A2 (solute carrier family 47 member 2)

Gene

• Entrez ID: 146802
• Gene name: Solute carrier family 47 member 2
• Gene symbol: SLC47A2
• Synonyms (NCBI Gene): MATE2, MATE2-B, MATE2-K, MATE2K
• Chromosome: 17
• Chromosome location: 17p11.2
• Summary: This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1364725	hsa-miR-129-5p	CLIP-seq
MIRT1364726	hsa-miR-1909	CLIP-seq
MIRT1364727	hsa-miR-4436b-3p	CLIP-seq
MIRT1364728	hsa-miR-450b-5p	CLIP-seq
MIRT1364729	hsa-miR-4694-5p	CLIP-seq
MIRT1364730	hsa-miR-507	CLIP-seq
MIRT1364731	hsa-miR-557	CLIP-seq
MIRT2466116	hsa-miR-2278	CLIP-seq
MIRT2466117	hsa-miR-2964a-5p	CLIP-seq
MIRT2466118	hsa-miR-3137	CLIP-seq
MIRT2466119	hsa-miR-3182	CLIP-seq
MIRT2466120	hsa-miR-3686	CLIP-seq
MIRT2466121	hsa-miR-4732-5p	CLIP-seq
MIRT2466122	hsa-miR-647	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA	19158817
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	16807400
GO:0015297	Function	Antiporter activity	IDA	16807400
GO:0015297	Function	Antiporter activity	IEA
GO:0015695	Process	Organic cation transport	IDA	16807400
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	TAS
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	TAS
GO:0140968	Function	Polyspecific organic cation:proton antiporter activity	IDA	16807400
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IEA

Other IDs

• MIM: 609833
• HGNC: 26439
• e!Ensembl: ENSG00000180638

Protein

• UniProt ID: Q86VL8
• Protein name: Multidrug and toxin extrusion protein 2 (MATE-2) (hMATE-2) (Kidney-specific H(+)/organic cation antiporter) (Solute carrier family 47 member 2)
• Protein function: Multidrug efflux pump that functions as a H(+)/organic cation antiporter. Mediates the efflux of cationic compounds, such as the model cations, tetraethylammonium (TEA) and 1-methyl-4-phenylpyridinium (MPP+), the platinum-based drug oxaliplatin
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01554	MatE	40 → 182	MatE	Family
  PF01554	MatE	297 → 458	MatE	Family

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: High expression in kidney. Very small expression in adrenal gland and lung. {ECO:0000269|PubMed:16807400, ECO:0000269|PubMed:21419862}.; TISSUE SPECIFICITY: [Isoform 3]: High expression in kidney. Very small expression in
• Sequence:

  MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCG
  HLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLL
  LCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWL
  KGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSV
  LNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML
  MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAAD
  TVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF
  EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFL
  ATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITL
  TTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT
  RH

• Sequence length: 602

Pathways

Reactome:

Transport of bile salts and organic acids, metal ions and amine compounds

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE INFERTILITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30951404	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37657024	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27959931		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28834135		★☆☆☆☆ Found in Text Mining only