Gene Gene information from NCBI Gene database.
Entrez ID 146713
Gene name RNA binding fox-1 homolog 3
Gene symbol RBFOX3
Synonyms (NCBI Gene)
FOX-3FOX3HRNBP3NEUN
Chromosome 17
Chromosome location 17q25.3
Summary This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-ri
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs972548690 G>A,T Pathogenic, likely-benign Stop gained, synonymous variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
21
miRTarBase ID miRNA Experiments Reference
MIRT1294322 hsa-miR-129-5p CLIP-seq
MIRT1294323 hsa-miR-2115 CLIP-seq
MIRT1294324 hsa-miR-4742-3p CLIP-seq
MIRT1294325 hsa-miR-516a-3p CLIP-seq
MIRT1552979 hsa-miR-1307 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616999 27097 ENSG00000167281
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NFN3
Protein name RNA binding protein fox-1 homolog 3 (Fox-1 homolog C) (Neuronal nuclei antigen) (NeuN antigen)
Protein function Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 101 169 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF12414 Fox-1_C 208 297 Calcitonin gene-related peptide regulator C terminal Family
Sequence
MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS
EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFG
QFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIE
VNNATARVMTN
KKTGNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGTAVAYRGAHLRGRGRAVYNTFRA
APPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAAAAYSDSYGRVYAAADPY
HHT
IGPAATYSIGTM
Sequence length 312
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
11
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Self-limited epilepsy with centrotemporal spikes Pathogenic rs972548690 RCV000656060
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EPILEPSY ClinGen, Disgenet, GenCC
ClinGen, Disgenet, GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EPILEPSY, ROLANDIC Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 28598851 Inhibit
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma Pubtator 29768357 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 27701470
★☆☆☆☆
Found in Text Mining only
Carcinoma Merkel Cell Merkel cell carcinoma Pubtator 34974547 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 27432190
★☆☆☆☆
Found in Text Mining only
Cleft Palate Cleft palate Pubtator 23512105 Associate
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 24215932 Associate
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Developmental disability Pubtator 24603971 Associate
★☆☆☆☆
Found in Text Mining only
Down Syndrome Down syndrome Pubtator 29509279, 35232286 Associate
★☆☆☆☆
Found in Text Mining only
Epilepsy Epilepsy BEFREE 24039908, 26619789, 27701470
★★☆☆☆
Found in Text Mining + Unknown/Other Associations