CSRP1 (cysteine and glycine rich protein 1)

Gene

• Entrez ID: 1465
• Gene name: Cysteine and glycine rich protein 1
• Gene symbol: CSRP1
• Synonyms (NCBI Gene): CRP, CRP1, CSRP, CYRP, D1S181E, HEL-141, HEL-S-286
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-fing

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001373	hsa-miR-1-3p	pSILAC	18668040
MIRT022790	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT023316	hsa-miR-122-5p	Microarray	17612493
MIRT001373	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT001373	hsa-miR-1-3p	Proteomics	18668040
MIRT659349	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT668887	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT668886	hsa-miR-4269	HITS-CLIP	23824327
MIRT668885	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT668884	hsa-miR-4514	HITS-CLIP	23824327
MIRT668883	hsa-miR-4692	HITS-CLIP	23824327
MIRT659348	hsa-miR-4315	HITS-CLIP	23824327
MIRT659347	hsa-miR-4640-5p	HITS-CLIP	23824327
MIRT659346	hsa-miR-4726-5p	HITS-CLIP	23824327
MIRT659345	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT659344	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT659343	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT659342	hsa-miR-5096	HITS-CLIP	23824327
MIRT668882	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT668881	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT668880	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT668879	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT668878	hsa-miR-3199	HITS-CLIP	23824327
MIRT668877	hsa-miR-8052	HITS-CLIP	23824327
MIRT668876	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT668875	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT668874	hsa-miR-587	HITS-CLIP	23824327
MIRT659349	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT659348	hsa-miR-4315	HITS-CLIP	23824327
MIRT659347	hsa-miR-4640-5p	HITS-CLIP	23824327
MIRT659346	hsa-miR-4726-5p	HITS-CLIP	23824327
MIRT659345	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT659344	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT659343	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT659342	hsa-miR-5096	HITS-CLIP	23824327
MIRT496033	hsa-miR-501-3p	PAR-CLIP	22291592
MIRT496032	hsa-miR-502-3p	PAR-CLIP	22291592
MIRT496031	hsa-miR-767-5p	PAR-CLIP	22291592
MIRT496033	hsa-miR-501-3p	PAR-CLIP	22291592
MIRT496032	hsa-miR-502-3p	PAR-CLIP	22291592
MIRT496031	hsa-miR-767-5p	PAR-CLIP	22291592
MIRT443365	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT443364	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT443363	hsa-miR-3161	PAR-CLIP	22100165
MIRT443362	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443361	hsa-miR-599	PAR-CLIP	22100165
MIRT659349	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT668887	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT668886	hsa-miR-4269	HITS-CLIP	23824327
MIRT668885	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT668884	hsa-miR-4514	HITS-CLIP	23824327
MIRT668883	hsa-miR-4692	HITS-CLIP	23824327
MIRT659348	hsa-miR-4315	HITS-CLIP	23824327
MIRT659347	hsa-miR-4640-5p	HITS-CLIP	23824327
MIRT659346	hsa-miR-4726-5p	HITS-CLIP	23824327
MIRT659345	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT659344	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT659343	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT659342	hsa-miR-5096	HITS-CLIP	23824327
MIRT668882	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT668881	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT668880	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT668879	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT668878	hsa-miR-3199	HITS-CLIP	23824327
MIRT668877	hsa-miR-8052	HITS-CLIP	23824327
MIRT668876	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT668875	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT668874	hsa-miR-587	HITS-CLIP	23824327
MIRT659349	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT659348	hsa-miR-4315	HITS-CLIP	23824327
MIRT659347	hsa-miR-4640-5p	HITS-CLIP	23824327
MIRT659346	hsa-miR-4726-5p	HITS-CLIP	23824327
MIRT659345	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT659344	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT659343	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT659342	hsa-miR-5096	HITS-CLIP	23824327
MIRT496033	hsa-miR-501-3p	PAR-CLIP	22291592
MIRT496032	hsa-miR-502-3p	PAR-CLIP	22291592
MIRT496031	hsa-miR-767-5p	PAR-CLIP	22291592
MIRT496033	hsa-miR-501-3p	PAR-CLIP	22291592
MIRT496032	hsa-miR-502-3p	PAR-CLIP	22291592
MIRT496031	hsa-miR-767-5p	PAR-CLIP	22291592
MIRT443365	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT443364	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT443363	hsa-miR-3161	PAR-CLIP	22100165
MIRT443362	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443361	hsa-miR-599	PAR-CLIP	22100165
MIRT913160	hsa-miR-1184	CLIP-seq
MIRT913161	hsa-miR-1225-5p	CLIP-seq
MIRT913162	hsa-miR-1245	CLIP-seq
MIRT913163	hsa-miR-1245b-3p	CLIP-seq
MIRT913164	hsa-miR-1293	CLIP-seq
MIRT913165	hsa-miR-129-3p	CLIP-seq
MIRT913166	hsa-miR-1297	CLIP-seq
MIRT913167	hsa-miR-190	CLIP-seq
MIRT913168	hsa-miR-190b	CLIP-seq
MIRT913169	hsa-miR-2355-3p	CLIP-seq
MIRT913170	hsa-miR-26a	CLIP-seq
MIRT913171	hsa-miR-26b	CLIP-seq
MIRT913172	hsa-miR-3606	CLIP-seq
MIRT913173	hsa-miR-3689a-5p	CLIP-seq
MIRT913174	hsa-miR-3689b	CLIP-seq
MIRT913175	hsa-miR-3689e	CLIP-seq
MIRT913176	hsa-miR-3689f	CLIP-seq
MIRT913177	hsa-miR-4255	CLIP-seq
MIRT913178	hsa-miR-4276	CLIP-seq
MIRT913179	hsa-miR-4453	CLIP-seq
MIRT913180	hsa-miR-4465	CLIP-seq
MIRT913181	hsa-miR-4483	CLIP-seq
MIRT913182	hsa-miR-4538	CLIP-seq
MIRT913183	hsa-miR-4641	CLIP-seq
MIRT913184	hsa-miR-4690-3p	CLIP-seq
MIRT913185	hsa-miR-4763-5p	CLIP-seq
MIRT913186	hsa-miR-539	CLIP-seq
MIRT913187	hsa-miR-676	CLIP-seq
MIRT913188	hsa-miR-921	CLIP-seq
MIRT913189	hsa-miR-1185	CLIP-seq
MIRT913190	hsa-miR-1233	CLIP-seq
MIRT913163	hsa-miR-1245b-3p	CLIP-seq
MIRT913165	hsa-miR-129-3p	CLIP-seq
MIRT913191	hsa-miR-1470	CLIP-seq
MIRT913192	hsa-miR-1827	CLIP-seq
MIRT913193	hsa-miR-1915	CLIP-seq
MIRT913194	hsa-miR-2682	CLIP-seq
MIRT913195	hsa-miR-31	CLIP-seq
MIRT913196	hsa-miR-3150a-3p	CLIP-seq
MIRT913197	hsa-miR-3175	CLIP-seq
MIRT913198	hsa-miR-3200-5p	CLIP-seq
MIRT913199	hsa-miR-342-5p	CLIP-seq
MIRT913200	hsa-miR-34a	CLIP-seq
MIRT913201	hsa-miR-34c-5p	CLIP-seq
MIRT913202	hsa-miR-3591-5p	CLIP-seq
MIRT913203	hsa-miR-3605-5p	CLIP-seq
MIRT913204	hsa-miR-3649	CLIP-seq
MIRT913205	hsa-miR-3665	CLIP-seq
MIRT913206	hsa-miR-3679-5p	CLIP-seq
MIRT913207	hsa-miR-3688-5p	CLIP-seq
MIRT913208	hsa-miR-3934	CLIP-seq
MIRT913209	hsa-miR-4460	CLIP-seq
MIRT913210	hsa-miR-4469	CLIP-seq
MIRT913211	hsa-miR-449a	CLIP-seq
MIRT913212	hsa-miR-449b	CLIP-seq
MIRT913213	hsa-miR-449c	CLIP-seq
MIRT913214	hsa-miR-4648	CLIP-seq
MIRT913215	hsa-miR-4649-3p	CLIP-seq
MIRT913216	hsa-miR-4650-5p	CLIP-seq
MIRT913217	hsa-miR-4651	CLIP-seq
MIRT913218	hsa-miR-4664-5p	CLIP-seq
MIRT913219	hsa-miR-4667-3p	CLIP-seq
MIRT913220	hsa-miR-4667-5p	CLIP-seq
MIRT913221	hsa-miR-4700-5p	CLIP-seq
MIRT913222	hsa-miR-4726-3p	CLIP-seq
MIRT913223	hsa-miR-4727-3p	CLIP-seq
MIRT913224	hsa-miR-515-3p	CLIP-seq
MIRT913225	hsa-miR-519e	CLIP-seq
MIRT913186	hsa-miR-539	CLIP-seq
MIRT913226	hsa-miR-608	CLIP-seq
MIRT913227	hsa-miR-644	CLIP-seq
MIRT913228	hsa-miR-661	CLIP-seq
MIRT913229	hsa-miR-939	CLIP-seq
MIRT913160	hsa-miR-1184	CLIP-seq
MIRT913189	hsa-miR-1185	CLIP-seq
MIRT913161	hsa-miR-1225-5p	CLIP-seq
MIRT913190	hsa-miR-1233	CLIP-seq
MIRT913230	hsa-miR-1260	CLIP-seq
MIRT913231	hsa-miR-1260b	CLIP-seq
MIRT913232	hsa-miR-1266	CLIP-seq
MIRT913165	hsa-miR-129-3p	CLIP-seq
MIRT913191	hsa-miR-1470	CLIP-seq
MIRT913233	hsa-miR-188-3p	CLIP-seq
MIRT913234	hsa-miR-216b	CLIP-seq
MIRT913169	hsa-miR-2355-3p	CLIP-seq
MIRT913195	hsa-miR-31	CLIP-seq
MIRT913235	hsa-miR-3124-3p	CLIP-seq
MIRT913236	hsa-miR-3127-5p	CLIP-seq
MIRT913237	hsa-miR-3150b-3p	CLIP-seq
MIRT913238	hsa-miR-3153	CLIP-seq
MIRT913239	hsa-miR-3156-3p	CLIP-seq
MIRT913240	hsa-miR-3176	CLIP-seq
MIRT913241	hsa-miR-3192	CLIP-seq
MIRT913198	hsa-miR-3200-5p	CLIP-seq
MIRT913203	hsa-miR-3605-5p	CLIP-seq
MIRT913242	hsa-miR-3613-3p	CLIP-seq
MIRT913243	hsa-miR-3614-3p	CLIP-seq
MIRT913244	hsa-miR-3664-3p	CLIP-seq
MIRT913205	hsa-miR-3665	CLIP-seq
MIRT913245	hsa-miR-3679-3p	CLIP-seq
MIRT913206	hsa-miR-3679-5p	CLIP-seq
MIRT913207	hsa-miR-3688-5p	CLIP-seq
MIRT913246	hsa-miR-3918	CLIP-seq
MIRT913247	hsa-miR-3921	CLIP-seq
MIRT913248	hsa-miR-3922-3p	CLIP-seq
MIRT913208	hsa-miR-3934	CLIP-seq
MIRT913249	hsa-miR-4251	CLIP-seq
MIRT913177	hsa-miR-4255	CLIP-seq
MIRT913178	hsa-miR-4276	CLIP-seq
MIRT913250	hsa-miR-4297	CLIP-seq
MIRT913251	hsa-miR-4300	CLIP-seq
MIRT913252	hsa-miR-4316	CLIP-seq
MIRT913253	hsa-miR-4329	CLIP-seq
MIRT913179	hsa-miR-4453	CLIP-seq
MIRT913210	hsa-miR-4469	CLIP-seq
MIRT913254	hsa-miR-4518	CLIP-seq
MIRT913182	hsa-miR-4538	CLIP-seq
MIRT913183	hsa-miR-4641	CLIP-seq
MIRT913215	hsa-miR-4649-3p	CLIP-seq
MIRT913255	hsa-miR-4653-5p	CLIP-seq
MIRT913219	hsa-miR-4667-3p	CLIP-seq
MIRT913184	hsa-miR-4690-3p	CLIP-seq
MIRT913256	hsa-miR-4710	CLIP-seq
MIRT913257	hsa-miR-4731-5p	CLIP-seq
MIRT913185	hsa-miR-4763-5p	CLIP-seq
MIRT913258	hsa-miR-4773	CLIP-seq
MIRT913259	hsa-miR-4784	CLIP-seq
MIRT913224	hsa-miR-515-3p	CLIP-seq
MIRT913225	hsa-miR-519e	CLIP-seq
MIRT913260	hsa-miR-548ac	CLIP-seq
MIRT913261	hsa-miR-548d-3p	CLIP-seq
MIRT913262	hsa-miR-548z	CLIP-seq
MIRT913227	hsa-miR-644	CLIP-seq
MIRT913187	hsa-miR-676	CLIP-seq
MIRT913263	hsa-miR-920	CLIP-seq
MIRT913189	hsa-miR-1185	CLIP-seq
MIRT1970840	hsa-miR-1253	CLIP-seq
MIRT913232	hsa-miR-1266	CLIP-seq
MIRT913236	hsa-miR-3127-5p	CLIP-seq
MIRT913238	hsa-miR-3153	CLIP-seq
MIRT913198	hsa-miR-3200-5p	CLIP-seq
MIRT913203	hsa-miR-3605-5p	CLIP-seq
MIRT913244	hsa-miR-3664-3p	CLIP-seq
MIRT913205	hsa-miR-3665	CLIP-seq
MIRT913206	hsa-miR-3679-5p	CLIP-seq
MIRT913207	hsa-miR-3688-5p	CLIP-seq
MIRT913246	hsa-miR-3918	CLIP-seq
MIRT913208	hsa-miR-3934	CLIP-seq
MIRT1970841	hsa-miR-3975	CLIP-seq
MIRT1970842	hsa-miR-4303	CLIP-seq
MIRT913254	hsa-miR-4518	CLIP-seq
MIRT913215	hsa-miR-4649-3p	CLIP-seq
MIRT1970843	hsa-miR-580	CLIP-seq
MIRT913227	hsa-miR-644	CLIP-seq
MIRT913208	hsa-miR-3934	CLIP-seq
MIRT2206591	hsa-miR-1207-5p	CLIP-seq
MIRT2206592	hsa-miR-2861	CLIP-seq
MIRT2206593	hsa-miR-4763-3p	CLIP-seq
MIRT2509857	hsa-miR-1	CLIP-seq
MIRT913189	hsa-miR-1185	CLIP-seq
MIRT2206591	hsa-miR-1207-5p	CLIP-seq
MIRT2509858	hsa-miR-1229	CLIP-seq
MIRT913190	hsa-miR-1233	CLIP-seq
MIRT913230	hsa-miR-1260	CLIP-seq
MIRT913231	hsa-miR-1260b	CLIP-seq
MIRT2509859	hsa-miR-1262	CLIP-seq
MIRT913165	hsa-miR-129-3p	CLIP-seq
MIRT2509860	hsa-miR-141	CLIP-seq
MIRT913191	hsa-miR-1470	CLIP-seq
MIRT913192	hsa-miR-1827	CLIP-seq
MIRT913233	hsa-miR-188-3p	CLIP-seq
MIRT913193	hsa-miR-1915	CLIP-seq
MIRT2509861	hsa-miR-200a	CLIP-seq
MIRT2509862	hsa-miR-206	CLIP-seq
MIRT2509863	hsa-miR-2115	CLIP-seq
MIRT913234	hsa-miR-216b	CLIP-seq
MIRT913194	hsa-miR-2682	CLIP-seq
MIRT2206592	hsa-miR-2861	CLIP-seq
MIRT913195	hsa-miR-31	CLIP-seq
MIRT913235	hsa-miR-3124-3p	CLIP-seq
MIRT2509864	hsa-miR-3126-5p	CLIP-seq
MIRT913196	hsa-miR-3150a-3p	CLIP-seq
MIRT913237	hsa-miR-3150b-3p	CLIP-seq
MIRT2509865	hsa-miR-3151	CLIP-seq
MIRT2509866	hsa-miR-3155	CLIP-seq
MIRT2509867	hsa-miR-3155b	CLIP-seq
MIRT913239	hsa-miR-3156-3p	CLIP-seq
MIRT913197	hsa-miR-3175	CLIP-seq
MIRT913240	hsa-miR-3176	CLIP-seq
MIRT2509868	hsa-miR-3180	CLIP-seq
MIRT2509869	hsa-miR-3180-3p	CLIP-seq
MIRT2509870	hsa-miR-3184	CLIP-seq
MIRT2509871	hsa-miR-3194-3p	CLIP-seq
MIRT2509872	hsa-miR-3196	CLIP-seq
MIRT913198	hsa-miR-3200-5p	CLIP-seq
MIRT2509873	hsa-miR-320a	CLIP-seq
MIRT2509874	hsa-miR-320b	CLIP-seq
MIRT2509875	hsa-miR-320c	CLIP-seq
MIRT2509876	hsa-miR-320d	CLIP-seq
MIRT2509877	hsa-miR-320e	CLIP-seq
MIRT2509878	hsa-miR-326	CLIP-seq
MIRT2509879	hsa-miR-330-5p	CLIP-seq
MIRT913199	hsa-miR-342-5p	CLIP-seq
MIRT913200	hsa-miR-34a	CLIP-seq
MIRT913201	hsa-miR-34c-5p	CLIP-seq
MIRT913202	hsa-miR-3591-5p	CLIP-seq
MIRT913203	hsa-miR-3605-5p	CLIP-seq
MIRT913242	hsa-miR-3613-3p	CLIP-seq
MIRT913243	hsa-miR-3614-3p	CLIP-seq
MIRT2509880	hsa-miR-3657	CLIP-seq
MIRT913244	hsa-miR-3664-3p	CLIP-seq
MIRT2509881	hsa-miR-3664-5p	CLIP-seq
MIRT913205	hsa-miR-3665	CLIP-seq
MIRT2509882	hsa-miR-3673	CLIP-seq
MIRT913245	hsa-miR-3679-3p	CLIP-seq
MIRT913206	hsa-miR-3679-5p	CLIP-seq
MIRT913207	hsa-miR-3688-5p	CLIP-seq
MIRT2509883	hsa-miR-3689d	CLIP-seq
MIRT2509884	hsa-miR-3690	CLIP-seq
MIRT2509885	hsa-miR-378g	CLIP-seq
MIRT2509886	hsa-miR-3909	CLIP-seq
MIRT2509887	hsa-miR-3919	CLIP-seq
MIRT913247	hsa-miR-3921	CLIP-seq
MIRT913248	hsa-miR-3922-3p	CLIP-seq
MIRT913208	hsa-miR-3934	CLIP-seq
MIRT1970841	hsa-miR-3975	CLIP-seq
MIRT2509888	hsa-miR-3977	CLIP-seq
MIRT2509889	hsa-miR-423-5p	CLIP-seq
MIRT913249	hsa-miR-4251	CLIP-seq
MIRT2509890	hsa-miR-4254	CLIP-seq
MIRT2509891	hsa-miR-4268	CLIP-seq
MIRT2509892	hsa-miR-4287	CLIP-seq
MIRT913250	hsa-miR-4297	CLIP-seq
MIRT2509893	hsa-miR-4299	CLIP-seq
MIRT2509894	hsa-miR-431	CLIP-seq
MIRT913253	hsa-miR-4329	CLIP-seq
MIRT2509895	hsa-miR-4419a	CLIP-seq
MIRT2509896	hsa-miR-4429	CLIP-seq
MIRT2509897	hsa-miR-4433	CLIP-seq
MIRT2509898	hsa-miR-4437	CLIP-seq
MIRT2509899	hsa-miR-4447	CLIP-seq
MIRT2509900	hsa-miR-4448	CLIP-seq
MIRT2509901	hsa-miR-4455	CLIP-seq
MIRT2509902	hsa-miR-4459	CLIP-seq
MIRT913209	hsa-miR-4460	CLIP-seq
MIRT913210	hsa-miR-4469	CLIP-seq
MIRT2509903	hsa-miR-4472	CLIP-seq
MIRT2509904	hsa-miR-4480	CLIP-seq
MIRT2509905	hsa-miR-4481	CLIP-seq
MIRT913211	hsa-miR-449a	CLIP-seq
MIRT913212	hsa-miR-449b	CLIP-seq
MIRT913213	hsa-miR-449c	CLIP-seq
MIRT2509906	hsa-miR-4510	CLIP-seq
MIRT2509907	hsa-miR-4511	CLIP-seq
MIRT2509908	hsa-miR-4646-5p	CLIP-seq
MIRT913215	hsa-miR-4649-3p	CLIP-seq
MIRT2509909	hsa-miR-4649-5p	CLIP-seq
MIRT913216	hsa-miR-4650-5p	CLIP-seq
MIRT913217	hsa-miR-4651	CLIP-seq
MIRT913255	hsa-miR-4653-5p	CLIP-seq
MIRT913218	hsa-miR-4664-5p	CLIP-seq
MIRT913219	hsa-miR-4667-3p	CLIP-seq
MIRT913220	hsa-miR-4667-5p	CLIP-seq
MIRT2509910	hsa-miR-4669	CLIP-seq
MIRT2509911	hsa-miR-4674	CLIP-seq
MIRT2509912	hsa-miR-4685-3p	CLIP-seq
MIRT2509913	hsa-miR-4695-5p	CLIP-seq
MIRT913221	hsa-miR-4700-5p	CLIP-seq
MIRT2509914	hsa-miR-4701-3p	CLIP-seq
MIRT2509915	hsa-miR-4714-3p	CLIP-seq
MIRT2509916	hsa-miR-4714-5p	CLIP-seq
MIRT2509917	hsa-miR-4722-5p	CLIP-seq
MIRT913222	hsa-miR-4726-3p	CLIP-seq
MIRT913223	hsa-miR-4727-3p	CLIP-seq
MIRT913257	hsa-miR-4731-5p	CLIP-seq
MIRT2509918	hsa-miR-4733-3p	CLIP-seq
MIRT2509919	hsa-miR-4745-5p	CLIP-seq
MIRT2206593	hsa-miR-4763-3p	CLIP-seq
MIRT2509920	hsa-miR-4768-3p	CLIP-seq
MIRT913258	hsa-miR-4773	CLIP-seq
MIRT913259	hsa-miR-4784	CLIP-seq
MIRT2509921	hsa-miR-484	CLIP-seq
MIRT2509922	hsa-miR-491-5p	CLIP-seq
MIRT2509923	hsa-miR-500a	CLIP-seq
MIRT913224	hsa-miR-515-3p	CLIP-seq
MIRT2509924	hsa-miR-515-5p	CLIP-seq
MIRT2509925	hsa-miR-516a-3p	CLIP-seq
MIRT2509926	hsa-miR-518a-3p	CLIP-seq
MIRT2509927	hsa-miR-518b	CLIP-seq
MIRT2509928	hsa-miR-518c	CLIP-seq
MIRT2509929	hsa-miR-518d-3p	CLIP-seq
MIRT2509930	hsa-miR-518f	CLIP-seq
MIRT913225	hsa-miR-519e	CLIP-seq
MIRT913186	hsa-miR-539	CLIP-seq
MIRT2509931	hsa-miR-541	CLIP-seq
MIRT913260	hsa-miR-548ac	CLIP-seq
MIRT2509932	hsa-miR-548b-3p	CLIP-seq
MIRT913261	hsa-miR-548d-3p	CLIP-seq
MIRT913262	hsa-miR-548z	CLIP-seq
MIRT2509933	hsa-miR-550b	CLIP-seq
MIRT2509934	hsa-miR-576-3p	CLIP-seq
MIRT913226	hsa-miR-608	CLIP-seq
MIRT2509935	hsa-miR-613	CLIP-seq
MIRT2509936	hsa-miR-642a	CLIP-seq
MIRT913227	hsa-miR-644	CLIP-seq
MIRT2509937	hsa-miR-654-5p	CLIP-seq
MIRT913228	hsa-miR-661	CLIP-seq
MIRT2509938	hsa-miR-760	CLIP-seq
MIRT2509939	hsa-miR-766	CLIP-seq
MIRT913229	hsa-miR-939	CLIP-seq
MIRT2509857	hsa-miR-1	CLIP-seq
MIRT913189	hsa-miR-1185	CLIP-seq
MIRT2206591	hsa-miR-1207-5p	CLIP-seq
MIRT2509858	hsa-miR-1229	CLIP-seq
MIRT913190	hsa-miR-1233	CLIP-seq
MIRT913230	hsa-miR-1260	CLIP-seq
MIRT913231	hsa-miR-1260b	CLIP-seq
MIRT2509859	hsa-miR-1262	CLIP-seq
MIRT913165	hsa-miR-129-3p	CLIP-seq
MIRT2509860	hsa-miR-141	CLIP-seq
MIRT913191	hsa-miR-1470	CLIP-seq
MIRT913233	hsa-miR-188-3p	CLIP-seq
MIRT913193	hsa-miR-1915	CLIP-seq
MIRT2509861	hsa-miR-200a	CLIP-seq
MIRT2509862	hsa-miR-206	CLIP-seq
MIRT2509863	hsa-miR-2115	CLIP-seq
MIRT913234	hsa-miR-216b	CLIP-seq
MIRT2206592	hsa-miR-2861	CLIP-seq
MIRT913235	hsa-miR-3124-3p	CLIP-seq
MIRT913196	hsa-miR-3150a-3p	CLIP-seq
MIRT913237	hsa-miR-3150b-3p	CLIP-seq
MIRT2509865	hsa-miR-3151	CLIP-seq
MIRT2509866	hsa-miR-3155	CLIP-seq
MIRT2509867	hsa-miR-3155b	CLIP-seq
MIRT913239	hsa-miR-3156-3p	CLIP-seq
MIRT913197	hsa-miR-3175	CLIP-seq
MIRT2509868	hsa-miR-3180	CLIP-seq
MIRT2509869	hsa-miR-3180-3p	CLIP-seq
MIRT2509870	hsa-miR-3184	CLIP-seq
MIRT2509872	hsa-miR-3196	CLIP-seq
MIRT913198	hsa-miR-3200-5p	CLIP-seq
MIRT2509873	hsa-miR-320a	CLIP-seq
MIRT2509874	hsa-miR-320b	CLIP-seq
MIRT2509875	hsa-miR-320c	CLIP-seq
MIRT2509876	hsa-miR-320d	CLIP-seq
MIRT2509877	hsa-miR-320e	CLIP-seq
MIRT2509878	hsa-miR-326	CLIP-seq
MIRT2509879	hsa-miR-330-5p	CLIP-seq
MIRT913202	hsa-miR-3591-5p	CLIP-seq
MIRT913203	hsa-miR-3605-5p	CLIP-seq
MIRT913242	hsa-miR-3613-3p	CLIP-seq
MIRT913243	hsa-miR-3614-3p	CLIP-seq
MIRT2509880	hsa-miR-3657	CLIP-seq
MIRT2509881	hsa-miR-3664-5p	CLIP-seq
MIRT2509882	hsa-miR-3673	CLIP-seq
MIRT913245	hsa-miR-3679-3p	CLIP-seq
MIRT913206	hsa-miR-3679-5p	CLIP-seq
MIRT2509883	hsa-miR-3689d	CLIP-seq
MIRT2509884	hsa-miR-3690	CLIP-seq
MIRT2509887	hsa-miR-3919	CLIP-seq
MIRT913247	hsa-miR-3921	CLIP-seq
MIRT913208	hsa-miR-3934	CLIP-seq
MIRT1970841	hsa-miR-3975	CLIP-seq
MIRT2509888	hsa-miR-3977	CLIP-seq
MIRT2509889	hsa-miR-423-5p	CLIP-seq
MIRT913249	hsa-miR-4251	CLIP-seq
MIRT2509890	hsa-miR-4254	CLIP-seq
MIRT2509891	hsa-miR-4268	CLIP-seq
MIRT2509892	hsa-miR-4287	CLIP-seq
MIRT913250	hsa-miR-4297	CLIP-seq
MIRT2509893	hsa-miR-4299	CLIP-seq
MIRT2509894	hsa-miR-431	CLIP-seq
MIRT913253	hsa-miR-4329	CLIP-seq
MIRT2509896	hsa-miR-4429	CLIP-seq
MIRT2509897	hsa-miR-4433	CLIP-seq
MIRT2509899	hsa-miR-4447	CLIP-seq
MIRT2509900	hsa-miR-4448	CLIP-seq
MIRT2509901	hsa-miR-4455	CLIP-seq
MIRT2509902	hsa-miR-4459	CLIP-seq
MIRT913209	hsa-miR-4460	CLIP-seq
MIRT913210	hsa-miR-4469	CLIP-seq
MIRT2509903	hsa-miR-4472	CLIP-seq
MIRT2509904	hsa-miR-4480	CLIP-seq
MIRT2509905	hsa-miR-4481	CLIP-seq
MIRT2509907	hsa-miR-4511	CLIP-seq
MIRT2509908	hsa-miR-4646-5p	CLIP-seq
MIRT913215	hsa-miR-4649-3p	CLIP-seq
MIRT2509909	hsa-miR-4649-5p	CLIP-seq
MIRT913216	hsa-miR-4650-5p	CLIP-seq
MIRT913255	hsa-miR-4653-5p	CLIP-seq
MIRT913219	hsa-miR-4667-3p	CLIP-seq
MIRT913220	hsa-miR-4667-5p	CLIP-seq
MIRT2509910	hsa-miR-4669	CLIP-seq
MIRT2509912	hsa-miR-4685-3p	CLIP-seq
MIRT2509913	hsa-miR-4695-5p	CLIP-seq
MIRT913221	hsa-miR-4700-5p	CLIP-seq
MIRT2509914	hsa-miR-4701-3p	CLIP-seq
MIRT2509915	hsa-miR-4714-3p	CLIP-seq
MIRT2509916	hsa-miR-4714-5p	CLIP-seq
MIRT2509917	hsa-miR-4722-5p	CLIP-seq
MIRT913222	hsa-miR-4726-3p	CLIP-seq
MIRT913223	hsa-miR-4727-3p	CLIP-seq
MIRT913257	hsa-miR-4731-5p	CLIP-seq
MIRT2509918	hsa-miR-4733-3p	CLIP-seq
MIRT2509919	hsa-miR-4745-5p	CLIP-seq
MIRT2206593	hsa-miR-4763-3p	CLIP-seq
MIRT913258	hsa-miR-4773	CLIP-seq
MIRT913259	hsa-miR-4784	CLIP-seq
MIRT2509921	hsa-miR-484	CLIP-seq
MIRT2509922	hsa-miR-491-5p	CLIP-seq
MIRT2509923	hsa-miR-500a	CLIP-seq
MIRT2509924	hsa-miR-515-5p	CLIP-seq
MIRT2509925	hsa-miR-516a-3p	CLIP-seq
MIRT2509926	hsa-miR-518a-3p	CLIP-seq
MIRT2509927	hsa-miR-518b	CLIP-seq
MIRT2509928	hsa-miR-518c	CLIP-seq
MIRT2509929	hsa-miR-518d-3p	CLIP-seq
MIRT2509930	hsa-miR-518f	CLIP-seq
MIRT913186	hsa-miR-539	CLIP-seq
MIRT2509931	hsa-miR-541	CLIP-seq
MIRT913260	hsa-miR-548ac	CLIP-seq
MIRT2509932	hsa-miR-548b-3p	CLIP-seq
MIRT913261	hsa-miR-548d-3p	CLIP-seq
MIRT913262	hsa-miR-548z	CLIP-seq
MIRT2509933	hsa-miR-550b	CLIP-seq
MIRT2509934	hsa-miR-576-3p	CLIP-seq
MIRT2509935	hsa-miR-613	CLIP-seq
MIRT2509936	hsa-miR-642a	CLIP-seq
MIRT2509937	hsa-miR-654-5p	CLIP-seq
MIRT913228	hsa-miR-661	CLIP-seq
MIRT2509939	hsa-miR-766	CLIP-seq
MIRT913229	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Activation	14522018
HNF1A	Unknown	18292576
REL	Activation	14522018
STAT3	Activation	8621622
STAT3	Unknown	18292576

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26924529
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0008270	Function	Zinc ion binding	TAS	1374386
GO:0008307	Function	Structural constituent of muscle	IBA
GO:0030018	Component	Z disc	IBA
GO:0042805	Function	Actinin binding	IBA
GO:0045214	Process	Sarcomere organization	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0060537	Process	Muscle tissue development	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070527	Process	Platelet aggregation	HMP	23382103

Other IDs

• MIM: 123876
• HGNC: 2469
• e!Ensembl: ENSG00000159176

Protein

• UniProt ID: P21291
• Protein name: Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1) (Epididymis luminal protein 141) (HEL-141)
• Protein function: Could play a role in neuronal development.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	10 → 66	LIM domain	Domain
  PF00412	LIM	119 → 175	LIM domain	Domain

• Sequence:

  MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
  CYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP
  RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGF
  GFGQGAGALVHSE

• Sequence length: 193

Pathways

KEGG:

Cytoskeleton in muscle cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATYPICAL ENDOMETRIAL HYPERPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX ENDOMETRIAL HYPERPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL HYPERPLASIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	10543406, 21627560, 28558744, 4085162		★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	30724385		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	22200909		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	17355554, 31356182		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	14592848, 15808757, 17044845, 18499652, 21310412, 21794939, 24709882, 24839357, 27543799, 27755007, 28277782, 29118583, 30268067, 30685100, 30808220, 31017470, 31020897, 31104078, 31144514, 31399624, 31699568		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	15966572, 23305094		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18200582, 18957790, 19122170		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	31713364		★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	12594844		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	31356989		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28294952, 28348184, 28428720, 28431197, 28513984, 28610827, 28693979, 29215538, 29370777, 29422392, 29505517, 29593801, 29644912, 29883632, 30136704, 30214418, 30233671, 30249565, 30558840, 30920289, 31068256, 31114724, 31180990, 31421975, 31507427, 31798002		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24762507, 28945626		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	25864110		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	24206575, 24762507		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	28394749		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	16221209		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11048804, 19077918, 19469014, 20333461, 28002874, 28348498, 28667300, 29802748		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	19469014, 20333461, 28348498, 28667300, 29074536		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	19048456		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30033839		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	7628587, 8605359		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28103926, 30053824		★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	31504969		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	16723442, 16849663, 17079491, 17293598, 17580967, 17675241, 18263814, 18538409, 18704199, 18786923, 19692124, 19850925, 20346514, 20605213, 20711705, 21203342, 22969267, 23548752, 26330749, 26961257, 27376713, 27778189, 28003224, 28095127, 28750115, 29599782, 29725335, 30013157, 30288946, 30552890		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	17079491		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	27510423		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	28729050		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29740659, 29869122, 30840592		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	29740659, 29869122		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	29740659		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	12372062, 22617718, 9279535		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17540481, 23254637	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19560102, 22133914, 22855860, 26343025, 29482610, 31201950, 34459398, 34920091, 35112776, 36550123, 38605603	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37679689	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	29972862		★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies, Familial	AMYLOID CARDIOMYOPATHY	BEFREE	6090552		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	14518665	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21756351, 27585799, 28707462, 30786810		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	31053293		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20583124, 28384752, 28663573		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	20583124	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	34075589	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	29577860		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	29740659		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16313263, 19029440, 22426798, 22973867, 24019411, 26775754, 27439595, 28096058, 28168662, 28169443, 28415034, 28512100, 28685921, 29016317, 29197366, 29219829, 29232169, 29258541, 29523566, 29620718, 30655091, 30726108, 30850153, 31016508, 31215277, 31253065, 31686344, 31701522		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	28671630, 32153255	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	30429373	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	31533836	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11001897, 23192499	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17897311, 24223742, 25378535, 37137941	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29232169		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	18829218	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	16409458, 17561469, 35942210	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	38250610	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	15757077, 16409458, 17161245, 35942210	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	32481400	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	14996590, 16409458, 17925606, 20346059, 21493817, 28277782, 29181731		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	18388036		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	24588117	Stimulate	★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	24588117, 30885236		★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	10449569		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	28953629, 31798280		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	32198016, 32387344	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	17459079, 18050373, 20030788, 2015008, 20300752, 20595269, 21402563, 23272049, 23960273, 25005770, 25036284, 25603416, 25962691, 26012572, 26186891, 26261626, 26480896, 26812031, 27309497, 27369645, 27825566, 27855973, 27911110, 27919202, 27974096, 28035438, 28043168, 28063070, 28248857, 28362980, 28445313, 28544533, 28610765, 28736223, 28766758, 28797160, 28971528, 29038299, 29067128, 29196383, 29278768, 29325529, 29530480, 29744553, 29961691, 29979389, 30022369, 30070923, 30075733, 30075808, 30089757, 30109794, 30178829, 30285828, 30293124, 30473179, 30624284, 30690799, 30729703, 30732197, 30768617, 30944131, 30947732, 30968207, 31267817, 31375691, 31522318, 31620171, 31637243, 31851643		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17722225		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28859917, 30237091, 30974894		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28960880, 31363467		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	32319118	Stimulate	★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	BEFREE	31474592		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	LHGDN	18801352		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	28810156		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28000423, 28183031, 28374419, 28419913, 28540928, 28704763, 29385150, 30143887, 30406721, 30670251, 30870771, 31163212, 31532458, 31823093		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	34135474, 34481527	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	36717689	Stimulate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	20194079		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28000423, 28183031, 28374419, 28419913, 28540928, 28704763, 29376460, 29385150, 30143887, 30199144, 30406721, 30670251, 30870771, 31163212, 31532458, 31823093		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	34135474	Stimulate	★☆☆☆☆ Found in Text Mining only
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	20194079		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29268541		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	34428207	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	18829218, 20620767, 32138469, 34387972, 34428207, 37751480, 39798633	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	29158612	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	12615785, 18829218, 19818961, 24135623, 28155626, 28475940, 28549956, 28699805, 28766358, 28843790, 30578072, 31310617		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	18829218		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	26473826		★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	26473826	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	16159975	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	30745535		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	21935671, 24717336, 25938632, 26473826, 28604834, 31674218		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	26473826, 31674218	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	26473826, 35684074	Stimulate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	26573997, 27331578, 27477876, 27625212, 27760719, 27872360, 28049113, 28089500, 28214863, 28456849, 28744697, 29264727, 29273360, 29527857, 29552432, 29708633, 29991774, 30112745, 30115255, 30287129, 30429680, 30723978, 30871739, 30918467, 30921220, 31041486, 31183274, 31189186, 31363467, 31452301, 31482635, 31503129, 31721396		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	30918467, 35693796, 36447423	Associate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29609021, 31637257		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	26864064, 37910111	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	22521605		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	22721676		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	24223742	Stimulate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	34852350	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10721674, 11448405, 11739967, 12578865, 12624280, 12665485, 12686665, 12933535, 12975260, 14744975, 14967730, 15517131, 15583733, 15756215, 15919817, 15920030, 15920036, 16005883, 16054696, 16087790, 16192648, 16390680, 16482986, 16580675, 16733231, 16803998, 16832152, 16900203, 16931792, 17004092, 17110595, 17223967, 17433639, 17584094, 17600233, 17702862, 18083122, 18217154, 18262272, 18327405, 18499652, 18551710, 18654002, 18714381, 18974302, 19013748, 19055599, 19076828, 19343415, 19359657, 19428053, 19480687, 19567438, 19624831, 19652664, 19695857, 19806245, 20131929, 20592751, 20656213, 20670634, 20682172, 21044781, 21136015, 21149301, 21262584, 21310412, 21411607, 21413847, 21601209, 22614118, 22688821, 22902395, 23087143, 23578356, 23690668, 24036889, 24226100, 24507791, 24517733, 24808639, 25265644, 26365974, 27342458, 27534721, 27993685, 28036158, 28051354, 28069582, 28099511, 28116969, 28376102, 28433861, 28647689, 28728065, 28739188, 28748694, 28850155, 28900428, 28930598, 29101255, 29111269, 29122097, 29525060, 29552019, 29644527, 29773576, 29888596, 30146678, 30186876, 30308507, 30452971, 30496036, 30685100, 30702995, 30735527, 30761006, 30771700, 30875492, 30924312, 30948779, 31138500, 31231231, 31337962, 31356182, 31381601, 31475703, 31481105, 31530175		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	LHGDN	16832147		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	36092791	Associate	★☆☆☆☆ Found in Text Mining only
Arteritis	Arteritis	Pubtator	29379005	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17075277	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	18226202, 24470327, 35265170, 40081912	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18797411, 23585841, 27053370, 28365582, 28604559, 29029330, 29395719, 29520264, 29724244, 30024658, 30100134, 30793870, 30846314, 30989408, 6335423		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	17075277, 21381000	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	17828345, 19852688, 24470327, 32295620, 40429765	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21811995, 24146263, 34011674	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	29587639	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10531075, 10765922, 14518665, 1466601, 16489709, 17075825, 18512711, 19389237, 20877716, 23039402, 23585841, 23897768, 24066004, 24549174, 25359432, 25889630, 25927832, 26226010, 26915672, 27043554, 27534721, 28255205, 29540200, 29561430, 30358109, 31736958, 31772500, 31876763, 31905737, 32168865, 32378457, 32508836, 33863328, 33875616, 34184082, 34499588, 34811816, 34931349, 35349660, 35776431, 36640055, 37382265, 38459704	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15593230, 18361097, 25598326, 26407995, 30124222, 33424834, 38418155	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	16406656, 28445313, 30989408, 31577714		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	24594669, 24696367, 25363664, 27327646, 27389865, 27444965, 27696727, 28356155, 28586166, 30299248, 30429706, 30756253, 30824647, 31070869, 31147798, 31199483, 31421033, 31646356		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	15034063, 18930989, 19468995, 23343469, 28288682, 28339365, 28365582, 28549945, 28673829, 28855173, 28950430, 29181622, 29329602, 29458278, 29901815, 29908669, 29961161, 29985080, 30076156, 30175554, 30237203, 30429706, 30542496, 30739130, 31249576, 31372851, 31590930, 31707982		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17650829, 18513241		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20298391, 21790705, 24956257, 27469060, 27476619, 28429138, 28441982, 28662937, 29227024, 29668337, 29777230, 29996681, 30053974, 30214033, 31496906		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27044366	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	24795153	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10721674, 11448405, 11739967, 12578865, 12624280, 12665485, 12686665, 12933535, 12975260, 14744975, 14967730, 15517131, 15583733, 15756215, 15919817, 15920030, 15920036, 16005883, 16054696, 16087790, 16192648, 16266402, 16390680, 16482986, 16580675, 16733231, 16803998, 16832152, 16900203, 16931792, 17004092, 17110595, 17223967, 17433639, 17584094, 17600233, 17702862, 18083122, 18217154, 18327405, 18499652, 18551710, 18654002, 18714381, 18974302, 19013748, 19055599, 19076828, 19343415, 19359657, 19428053, 19480687, 19567438, 19624831, 19652664, 19695857, 19806245, 20131929, 20592751, 20656213, 20670634, 20682172, 21044781, 21136015, 21149301, 21247529, 21262584, 21310412, 21411607, 21413847, 21601209, 22614118, 22688821, 22902395, 23087143, 23578356, 23690668, 24036889, 24226100, 24507791, 24517733, 24808639, 25265644, 26365974, 27342458, 27534721, 27993685, 28036158, 28051354, 28069582, 28116969, 28376102, 28433861, 28647689, 28728065, 28739188, 28748694, 28850155, 28900428, 28930598, 29101255, 29111269, 29525060, 29552019, 29644527, 29773576, 29888596, 30146678, 30186876, 30308507, 30452971, 30461627, 30496036, 30685100, 30702995, 30735527, 30761006, 30771700, 30875492, 30924312, 30948779, 31138500, 31231231, 31337962, 31356182, 31381601, 31475703, 31481105, 31530175		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14688701, 15467191, 15704532, 15793305, 16054696, 16141529, 16580524, 17467420, 17652082, 18621860, 18714381, 18957790, 19008293, 19076828, 19567438, 19624831, 20364851, 20690093, 21562922, 23087143, 23111890, 23149874, 23445482, 24337102, 24711458, 26348353, 27534721, 28761062, 31118224, 31901246, 32358950, 33167400, 35428187, 37744231, 38104193, 39227703, 40617584	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	14744975, 15306744, 16087790, 16832152, 17138933, 17261875, 17714718, 17885262, 17917609, 18023360, 18083122, 18551710, 18810717		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	CTD_human_DG	16931792		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19620133	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	LHGDN	15772777, 18393253, 18523031		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	16601211, 16623947, 20458440, 20797493, 22329434, 23397981, 23713812, 24118451, 24332149, 25711952, 27386883, 27915263, 28040764, 28043678, 28244597, 28498565, 28506639, 28639986, 28977057, 29022500, 29118378, 29161368, 29197340, 29354906, 29384058, 29558818, 29573355, 30201110, 30232315, 30409736, 30473335, 30626765, 30683618, 30726858, 30921230, 31391207, 31699451, 31776769, 31820271		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	16623947, 19645035, 20797493, 31391207, 33461844, 36801832	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19117239, 22329434, 23437133, 24118451, 25037055, 28498565, 30180182, 32993521, 34931349	Associate	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	11752512, 28673829, 29243511		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	11752512, 28673829, 29243511		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	21633121	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	24240495, 38066446	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28194004, 31312974		★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	CTD_human_DG	22248470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	19850925		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27093065, 33187600	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	11752512, 28673829, 29243511, 31591381		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	27744125		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	22333691		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10675363, 36706536	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15531769, 16463424, 17108227, 18182444, 18853133, 19155486, 19799114, 19950324, 27654215, 29528865, 30282476, 30639645, 30924312, 31268423, 31283835		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16380821		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	16463424	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	30291762		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	19400955		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18550640, 27171829, 28770703, 30101545, 31036056, 31602349		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	25759827, 36864496	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	29534057, 29854799, 40616106	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27658341, 31165507		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	23905873, 27104679	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	29232169		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30745535		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	LHGDN	18297417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	23031404, 26250741, 27744125, 27856235, 28194004, 28374603, 28416092, 28764912, 28867283, 29065864, 29306698, 30388399, 30597323, 30617377, 30762747, 31203140, 31532468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23031404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	25781172	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	30617377, 34386016, 34979555, 35377256, 37659117	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	30560764		★☆☆☆☆ Found in Text Mining only
Bipolar II disorder	Bipolar Disorder	BEFREE	26895280		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	26658659, 33787566, 34187873	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	27230223		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	19552682	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	22022418	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	25889630	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	29233917		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	34653076	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	29668751		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	27744125		★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE D	Brachydactyly	BEFREE	29554535		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	29846497		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	32358385	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	LHGDN	15746456		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain infarction	Pubtator	18436879	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	23763486, 30863888		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	23452299	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	36017774	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	23643286	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	24657059		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11241275, 20727736, 21496483, 23627410, 23955082, 23991131, 24835491, 25339205, 26130675, 27780363, 27914795, 28042070, 28292922, 28489884, 28559409, 28617135, 28641369, 28846105, 28983080, 29178353, 29668832, 29921457, 29974464, 30293230, 30962499, 31138314, 31182704, 31186728, 31443226, 31454519, 31642812		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23991131, 24036889, 24633920, 25339205, 25340395, 26310275, 28489884, 32444848, 32928877, 34572592, 36766731	Associate	★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	20012460		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	29270068, 29746946		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	31503552	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	30044057		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	23698479		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	21872279	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	30684474		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	27744125, 28839172		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	28839172, 34465876	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	28839172	Stimulate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	28915665, 31302740		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	25778334	Stimulate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	37712645	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	27164190	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis cutis	Calcinosis cutis	BEFREE	27164190		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	31573353		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	29808625		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25025473, 28923830	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28489774		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16269426, 17513780, 2154496, 22821639, 25027406, 26884882, 30025407, 32076459, 32363617, 3375054, 34086854, 35157721, 9949173	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	22267767	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17114654, 18402527, 20421535, 20727736, 23254959, 24139238, 24633920, 25422226, 25999661, 27230571, 27785660, 28199511, 28472743, 28577953, 28981818, 29851300, 29941786, 30078713, 30113495, 30297515, 30521079, 30558004, 30606716, 31142628, 31559588, 31565153, 31579619, 31668096		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30230959, 35328734, 35859428	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16221209, 21086092, 28875953, 28923830, 29890986, 30741998, 31723229, 37455213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29385406	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	17024120	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22159575		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29557695		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19196186, 27516000, 28834887, 28935270, 31462430		★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	20733302, 26355258		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112, 34598979	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	21458205	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31820271		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	16087131, 19645035, 25827698	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19343415		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	32806998	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10634818, 11739967, 12186793, 12551862, 12615785, 12842840, 15010279, 15078802, 15135696, 15136507, 15184288, 15198961, 15205588, 15306179, 15345506, 15522960, 15529024, 15539624, 15756215, 15882283, 15920036, 16192648, 16246904, 16389127, 16458279, 16534007, 16682383, 16731635, 16807407, 16809555, 16840032, 16900203, 16916988, 16958597, 17044846, 17101857, 17110595, 17158147, 17164456, 17185152, 17335789, 17426996, 17508011, 17584093, 17702862, 17868801, 17878255, 17885212, 17886064, 18216863, 18241613, 18262272, 18285551, 18339698, 18436884, 18702945, 18805107, 18829218, 18937150, 19033005, 19074515, 19075099, 19077918, 19095731, 19114670, 19228486, 19262552, 19395102, 19410251, 19426506, 19587606, 19617288, 19667982, 19695857, 20031577, 20131929, 20157054, 20184533, 20400278, 20682172, 20686879, 20716378, 20733302, 20876875, 21044752, 21057970, 21062467, 21146168, 21149301, 21293934, 21300955, 21406102, 21413847, 21493817, 21601209, 21682549, 21915265, 21940940, 22241816, 22383552, 22889949, 22982460, 23360434, 23708174, 23727085, 23741513, 23940726, 23977389, 24226100, 24582179, 24643644, 24671014, 24763700, 25187575, 25296580, 25502724, 25530260, 25827033, 26222902, 26302167, 26438598, 26487741, 26920376, 27487299, 27534721, 27549083, 27580453, 27670684, 27774694, 27782866, 27886564, 27899528, 27986842, 28004063, 28036163, 28160962, 28176762, 28202840, 28219664, 28301500, 28332877, 28341375, 28360032, 28378496, 28428221, 28430145, 28431362, 28477314, 28536575, 28537577, 28574077, 28628373, 28666597, 28728065, 28764912, 28811734, 28847550, 28868218, 28883850, 28885336, 28912752, 28947858, 28951559, 28969969, 28988163, 29023325, 29033897, 29042430, 29054144, 29066453, 29069022, 29070829, 29081337, 29101255, 29120646, 29128340, 29146277, 29223110, 29243511, 29258216, 29298330, 29320465, 29402404, 29415228, 29431855, 29438198, 29520828, 29552019, 29569857, 29575002, 29630504, 29714643, 29880326, 29892284, 29895294, 29895378, 29925274, 29932219, 29939848, 29946323, 29951035, 29951057, 29962216, 29967567, 29969584, 29992240, 30025407, 30036522, 30058841, 30086945, 30097651, 30128921, 30179123, 30213651, 30220259, 30352748, 30412726, 30439985, 30461627, 30496036, 30530521, 30586738, 30727837, 30854952, 30946765, 31020672, 31023227, 31062578, 31089857, 31104078, 31151201, 31171528, 31184646, 31195938, 31220998, 31239251, 31319037, 31337127, 31400725, 31434843, 31473619, 31477553, 31480611, 31492654, 31504216, 31504409, 31608753, 31622379, 31662403, 31791637, 31826385, 31835088, 31840602		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	12876635, 16332659		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	15591095, 16246904, 16840032, 17158147, 17477779, 18216863, 18285551, 18829218, 19077918, 19262552, 20031577, 20686879, 21062467, 21139111, 21173097, 21937998, 22038335, 23111890, 23257395, 23294625, 23445482, 23968978, 24029867, 24337102, 24795153, 25187575, 25827033, 25965853, 26357470, 26398850, 26751459, 26891844, 27738391, 29081337, 29316941, 29320465, 29740659, 30866520, 32639518, 35197177, 35428187, 35458670, 36273209, 37443809, 37782172	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15735209, 15853546, 15859024, 16731635, 17044846, 17138933, 17164456, 17395501, 17714716, 17917609, 18436884, 18500540, 18688084, 18702945, 18753952		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	16460549, 17497040, 20716378, 22133914, 29146277, 30004115, 30025407	Stimulate	★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	CTD_human_DG	20361910		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	16908949, 17885262		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	32321443	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	36083252	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	19428053, 28376102, 28685957, 28728065, 30318598		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	11739967, 29325936		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	17920229, 18421029		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	27738391	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	32873770	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	31081067	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31225969		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	25315615, 25367052, 27705004, 27852346, 27887037, 27911103, 28076309, 28778617, 29465542, 29600325, 29738010, 29746377, 29911753, 30107791, 30285748, 30366226, 30471269, 31120857, 31195938, 31284034, 31291389, 31540339, 31851288		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	30568541, 31816123		★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	28852010, 29084081		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	29846497		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	19262552	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	BEFREE	1615471		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	18810599		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	19262552, 20145391, 20686879, 26718567, 27554116, 28498565, 29081337, 31192907, 34931349, 35862251, 40135578	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27460564, 33378050	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29101255, 30804318, 31192907, 31814529		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28340377, 31779506		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	17600233, 30355213, 31830923		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	30680005		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11739967, 16051899, 16210572, 16601211, 16809564, 17355554, 18439548, 19170684, 19262552, 19390179, 19587606, 20131929, 20184533, 20464061, 20733302, 20876875, 21356305, 21493817, 21541851, 22875596, 23046580, 23741513, 23980698, 24231564, 24636767, 24771073, 26718567, 27050473, 27580453, 27682880, 27813265, 27825611, 27979431, 28004063, 28017191, 28117601, 28135841, 28166784, 28171699, 28181636, 28275651, 28293738, 28302952, 28437380, 28567089, 29081337, 29224120, 29227024, 29451096, 29466947, 29548857, 29556980, 29664664, 29685722, 29869620, 30056003, 30120036, 30160575, 30196790, 30318492, 30354651, 30613458, 30729371, 30738244, 30824395, 30991382, 31010048, 31356182, 31461209, 31477553, 31520899, 31641377, 31699451, 31701522, 31738143, 31810721, 31826385, 31841043		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	14500938, 16051899, 16087807, 17355554, 17597836, 17878721		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	18971492, 19652664		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	18971492	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21737650, 28901315, 29126926		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28835362, 31658143		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21737650, 28901315, 29126926		★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	34645833	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18938071, 28166534		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34086854	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	29480416		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	36868481	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	Pubtator	25550870	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29370777		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	28799434, 29370777, 30405319		★☆☆☆☆ Found in Text Mining only
Cholesteryl Ester Transfer Protein Deficiency	Hyperalphalipoproteinemia	BEFREE	12701054		★☆☆☆☆ Found in Text Mining only
Chorea Acanthocytosis Syndrome	Chorea	BEFREE	23568775		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	31323005		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	18361097, 40277034	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	25393688, 28077069, 30816254, 34386016	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	23773925		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28923305, 29627531, 31350553, 31358306		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	27877078, 28956241, 29330688, 29761287, 29926516, 30465136, 31049900, 31101015		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18048420, 19965533, 21569369, 27312245, 28017325, 28378496, 28439760, 28830726, 28833735, 28856612, 28956241, 28969969, 29088847, 29330688, 29572679, 29616745, 29617004, 29856477, 29992694, 30200074, 30361848, 30473335, 30561114, 30659283, 31062264, 31204773, 31222137, 31306043, 31336254, 31338797, 31377747, 31382219, 31591375		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	28058664		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27595291		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16971405, 19096002, 19272152, 20298391, 21059738, 22100366, 22165675, 22424427, 23267696, 26096858, 26722511, 27003100, 28143876, 28185443, 28490868, 28672914, 28680355, 28832630, 29117798, 29227024, 29347936, 29403273, 29518064, 29529843, 30005623, 30058599, 30114262, 30236113, 30572222, 30584402, 30659283, 30666727, 30674312, 30773817, 30880285, 31049771, 31153743, 31291514, 31383234, 31564851, 31629111, 31695352, 31695395		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17400881, 19281089		★☆☆☆☆ Found in Text Mining only
Chronic osteomyelitis	Osteomyelitis	BEFREE	28770614		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	23592000, 27068411, 28598285, 29520783, 30199858, 30903199		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23592000	Associate	★☆☆☆☆ Found in Text Mining only
Chronic recurrent multifocal osteomyelitis	Recurrent multifocal osteomyelitis	Pubtator	29565497	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic recurrent multifocal osteomyelitis	Recurrent multifocal osteomyelitis	Pubtator	36456962	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22333691, 28614777, 28840619, 29331339, 29658815, 29972862, 30810658, 31486016, 31539885, 31582968		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28618965, 28875953, 30213543		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	17498578, 28416092, 30364161		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17498578, 20065134, 21790705, 21915265, 22895578, 24997674, 25609760, 31201950, 34824534, 35027554, 35593028	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17540481, 24305621	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35503943	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	22855860	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24363525, 27001939, 29232715, 33911469, 37710023	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32724277	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19077918, 20949557, 21060154, 22394005, 26628300, 29181397, 29246519, 29779798, 31622379		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17806085		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	19077918	Associate	★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	BEFREE	27432441		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19187582, 19469014, 19760027, 20333461, 21293934, 23755178, 24036889, 24761881, 24835491, 25025473, 25043606, 25840921, 26628300, 26735530, 27504605, 28132052, 28207541, 28251379, 28376082, 28685921, 28918433, 29133757, 29630649, 29874787, 29946884, 30004836, 30154846, 30157754, 30210632, 30368730, 30476131, 30817357, 31023832, 31141720, 31335668, 31758273, 31802946		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18005189		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19077918, 19760027, 20949557, 22216763, 23755178, 24036889, 25025473, 25043606, 26735530, 27738330, 29246519, 29630649, 30368730, 30476131, 33413474, 34386016, 34888857, 35652588, 35739525, 36996866, 37006231, 37770864, 38459704, 40224486	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25472811, 29874787	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	35767121	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	31798280		★☆☆☆☆ Found in Text Mining only
Complex Endometrial Hyperplasia	Endometrial Hyperplasia	CTD_human_DG	22248470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29128864		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15359986, 17296972		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	29216632, 29438557		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	27118988, 30010900		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Congenital hemidysplasia with ichthyosiform erythroderma and limb defects	Pubtator	25997771	Associate	★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	15571908		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	16360360		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16802372, 17652883, 19343415, 19587606, 20371666, 21220701, 21519150, 22875408, 23861484, 26864064, 27384414, 27605566, 27730663, 28542263, 28684396, 28832572, 28838148, 28883850, 28923305, 29066436, 29169753, 29306896, 29382606, 29396658, 29627531, 29633232, 29685722, 29710336, 29771963, 29934374, 30003856, 30427997, 30716591, 30773798, 30819375, 30853478, 31032644, 31104823, 31220103, 31339853, 31350553, 31358306, 31400725, 31596459, 31603935		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	17108227, 31367484		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16221209, 27255479, 27907929, 28624829, 28859644, 28875953, 28923830, 29080691, 30213543, 31263677, 31311108, 31644587, 31723229		★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	BEFREE	31599438		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	23121676	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	17222519, 28612914		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	18753723	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	26993229	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10541503, 10982535, 11739967, 12842840, 12921979, 14606608, 14645206, 15379752, 15517131, 15790934, 15886815, 16176166, 16389127, 16409458, 16630992, 16682383, 17003932, 17056323, 17101857, 17219082, 17627106, 17827818, 17924842, 18167554, 18401567, 18499652, 18609102, 18714384, 18823504, 19114670, 19280766, 19567438, 19624831, 19892791, 20131929, 20368232, 20580041, 20668462, 20876875, 20973705, 20978399, 21062467, 21300955, 21310412, 21325005, 21441231, 21720757, 21848660, 21934067, 21965185, 22056216, 22383552, 23392788, 24342328, 24808639, 24965144, 25187575, 25822970, 26266345, 26751459, 27327646, 27487299, 27566532, 27955950, 28153212, 28428450, 28569269, 28760202, 28764912, 28942872, 29066452, 29097387, 29172653, 29375221, 29515239, 29547707, 29635941, 29888596, 29980052, 30186434, 30364730, 30371339, 30505168, 30509306, 30548615, 30571591, 30591805, 30854952, 30912862, 31157268, 31217396, 31325043, 31416781, 31630099, 31694563, 31707846, 31773710		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	24868163		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10541503, 10982535, 11739967, 12842840, 12921979, 14741073, 15302103, 15379752, 15517131, 15571826, 15632890, 15790934, 15886815, 16176166, 16368710, 16389127, 16409458, 16630992, 16682383, 17003932, 17056323, 17101857, 17219082, 17561469, 17627106, 17827818, 17924842, 18167554, 18279814, 18281810, 18401567, 18425592, 18499652, 18571179, 18609102, 18714384, 18823504, 18842780, 19114670, 19280766, 19349293, 19446283, 19567438, 19624831, 19628406, 19876063, 19892791, 20368232, 20383745, 20580041, 20668462, 20876875, 20936901, 20973705, 20978399, 21062467, 21231776, 21300955, 21310412, 21325005, 21441231, 21720757, 21934067, 21965185, 22056216, 22153698, 22383552, 22834788, 23392788, 23639635, 24072607, 24342328, 24530664, 24717336, 24808639, 24965144, 25187575, 25197382, 25617388, 25822970, 26266345, 26751459, 26791863, 26864064, 27327646, 27487299, 27566532, 27714720, 27955950, 28153212, 28233393, 28397248, 28428450, 28542263, 28559532, 28569269, 28686695, 28760202, 28764912, 28789919, 28826313, 28942872, 29066452, 29097387, 29109596, 29172653, 29375221, 29444778, 29547707, 29635941, 29667724, 29789902, 29888596, 29890282, 29958048, 29980052, 30001869, 30186434, 30359586, 30371339, 30505168, 30509306, 30548615, 30571591, 30591805, 30790162, 30854952, 30866520, 30912862, 30943979, 31079089, 31157268, 31217396, 31233399, 31325043, 31416781, 31630099, 31694563, 31707846, 31735728, 31773710		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	15585215, 16778366, 17380191, 17499233, 17763921, 18216376, 18418236, 18609102, 18753723		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16409458, 17263916, 17561469, 20368232, 20377327, 22834788, 24217304, 24363620, 25187885, 25197023, 25197382, 25467832, 26487741, 26751459, 26771969, 26864064, 28233393, 28686695, 30912862, 32215496, 34931349, 37239434, 37782172, 37820655, 37824465, 38270950, 38290570, 38459704, 38642556, 39863282, 40020258	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17561469, 31000184	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	24868163		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	17827818, 18167554, 18714384, 19567438, 19624831, 21029470, 23049543, 25082230, 25683698, 27554116, 27560308, 31694563, 32215496, 33660877, 34861059, 35782064, 37566005, 38421485	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27955950	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10541503, 10982535, 11448405, 11739967, 12454321, 12701054, 12842840, 12921979, 15105038, 15379752, 15517131, 15585218, 15790934, 15886815, 16098388, 16176166, 16269662, 16389127, 16409458, 16445917, 16630992, 16682383, 17003932, 17056323, 17101857, 17219082, 17483111, 17627106, 17827818, 17924842, 18167554, 18401567, 18425592, 18499652, 18609102, 18714384, 18823504, 18950733, 19114670, 19280766, 19567438, 19624831, 19892791, 20096599, 20368232, 20580041, 20668462, 20876875, 20973705, 20978399, 21062467, 21300955, 21310412, 21325005, 21441231, 21481392, 21720757, 21934067, 21965185, 22056216, 22383552, 22717643, 22910756, 23392788, 24342328, 24808639, 24965144, 25082230, 25187575, 25781951, 25822970, 26266345, 26751459, 27327646, 27487299, 27554116, 27566532, 27814628, 27955950, 28004063, 28153212, 28428450, 28569269, 28585121, 28760202, 28764912, 28775061, 28915434, 28942872, 28965605, 29066452, 29069022, 29097387, 29172653, 29375221, 29547707, 29635941, 29731838, 29771963, 29807048, 29888596, 29979375, 29980052, 30053815, 30186434, 30371339, 30505168, 30509306, 30548615, 30571591, 30591805, 30658102, 30737465, 30854952, 30912862, 30928231, 30943979, 31157268, 31217396, 31325043, 31416781, 31630099, 31694563, 31707846, 31769325, 31770616, 31773710, 31805680		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	12151853, 12835213, 12842840, 15585208, 15585218, 15653107, 15887860, 16409458, 17101857, 18036188, 18403728		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	14688701, 38432855	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	29064537	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	LHGDN	15585215, 17126343		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	31233098, 31773710		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	33028234	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Coronary vasospasm	Pubtator	35096275	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	23612495	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	27994452	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	27076371, 28234665		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	37972579	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	CTD_human_DG	11339241		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12190096, 12811429, 16344720, 16497618, 16707968, 16984505, 17001292, 18566104, 21251066, 22699834, 23358932, 25208103, 25636121, 26836588, 27096233, 27327646, 27489241, 27556489, 27737498, 27741061, 27930409, 28002129, 28422861, 28498155, 28512287, 28523450, 28567115, 28588890, 28613228, 28622356, 28731502, 28816962, 28817462, 28945636, 29084078, 29096949, 29097934, 29108979, 29112087, 29159893, 29257147, 29348747, 29409871, 29466406, 29466790, 29489472, 29501599, 29623105, 29697457, 29704680, 29718222, 29756637, 29776017, 29912382, 29950897, 29987967, 30006816, 30140279, 30165638, 30237086, 30303822, 30407616, 30516330, 30558634, 30601426, 30602165, 30625276, 30628981, 30650133, 30650312, 30665494, 30697961, 30768123, 30791776, 30873890, 30874986, 31080419, 31083541, 31148906, 31194979, 31303093, 31327404, 31378118, 31499013, 31532265, 31541367, 31651651, 31689999, 31729323, 31737782, 31749597, 31764416, 31769537		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	16984505, 18566104		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20117339, 22699834, 25883416, 27021506, 31415355, 32840322, 35751647, 35908771, 36817485	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20564534, 32724277	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	11339241		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	11339241		★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	32358950	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	24364468		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25146850, 28178305, 28884501, 30387311		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	28178305, 31582896, 31870630	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	24146927	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	15735799, 16352308, 18394684, 18600090, 28676651, 29914404, 30103053		★☆☆☆☆ Found in Text Mining only
deficiency of adenosine deaminase 2	Adenosine deaminase 2 deficiency	Pubtator	29681619	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18055473, 20511616, 23343469, 27327646, 28445313, 28766758, 29101675, 29128509, 29164428, 29304778, 29758352, 30022370, 30219766, 30248505, 30271156, 30600472, 31102776, 31238698		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	28171699, 28542645, 29958865		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	27160518, 28338222, 28555781, 28940461, 29061098, 29287809, 29529166, 30424994, 31058343, 31761478, 31770149		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	27160518, 29529166, 31761478, 36567636	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16854501, 17158432, 17540481, 19245412, 21116047, 22213409, 22895578, 26725994, 27861706, 28159467, 29016447, 29273039, 29451096, 30863888		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	16854501, 18541797		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	17158432, 33403740	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	17540481, 22895578	Inhibit	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	19560102, 22133914	Stimulate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	LHGDN	18841009		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28159467		★☆☆☆☆ Found in Text Mining only
Dental Diseases	Dental Diseases	BEFREE	28513060		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	29658815		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	30102967		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	29654412		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	19073752, 21296145, 24182629, 25603415, 25976322, 29764522, 30886334, 31022775, 32198016, 32624019, 33079133, 34481527, 35113419, 36225923, 37659117, 39863282	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19433520, 19796676, 19892791, 20836906, 20955778, 21296145, 22580182, 23277135, 24246360, 25603415, 25683698, 26846364, 26895280, 27384414, 27562420, 27816325, 28000423, 28128231, 28135632, 28152396, 28181636, 28183031, 28187400, 28257825, 28318471, 28419913, 28501736, 28558901, 28600633, 28645055, 28701268, 28704763, 28867280, 28867283, 28916991, 29016549, 29028592, 29156363, 29196383, 29218020, 29237576, 29303703, 29340226, 29422922, 29489077, 29518064, 29550676, 29575958, 29654412, 29721726, 29787958, 29849779, 29895893, 29928963, 29979617, 30048584, 30097134, 30098513, 30102967, 30104698, 30126458, 30172071, 30182258, 30389462, 30394311, 30405261, 30426235, 30521079, 30581212, 30624288, 30760746, 30819515, 30822466, 30854996, 30886334, 30899619, 30955108, 30958417, 31022775, 31109116, 31258105, 31267614, 31319037, 31377557, 31479683, 31615595, 31665233, 31707310, 31711279, 31823093		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	20836906, 25683698, 34135474, 35560157	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27232630	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	29764522, 32198016, 32387344, 35039097	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31443670		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	34045476	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30520087		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28902946, 30382002		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28103926, 28766758, 30053824		★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	30068766		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10982535, 10985497, 12454321, 12618085, 12915627, 14741073, 14988254, 15080783, 15277436, 15379752, 15632890, 15833936, 16002077, 16389127, 16644712, 17004092, 17327459, 17332447, 17343862, 17426996, 18401567, 18439548, 18551710, 18700811, 18852330, 19095725, 19712989, 19892791, 20400278, 20661421, 20716378, 21094359, 21149504, 21184785, 21270276, 21493817, 21525158, 21700917, 23274901, 23340375, 23708174, 23985808, 24286720, 24582179, 25986660, 26794963, 27273455, 27298824, 27395328, 27450396, 27856516, 27955950, 28403353, 28666597, 28759613, 28780750, 28801571, 28809726, 28834086, 28853729, 29379005, 29390435, 29476733, 29657148, 29664664, 29739462, 29762755, 29777230, 29803192, 29851359, 29866373, 29982147, 30026044, 30077872, 30174285, 30181854, 30553025, 30587667, 30592706, 30660850, 30684651, 30685423, 30824395, 30826804, 30895902, 30950561, 30959530, 31006835, 31093931, 31154826, 31208420, 31321988, 31330062, 31371431, 31427179, 31434843, 31471378, 31473619, 31501920, 31581728, 31770616, 31781724, 31814529, 31841043		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	21029470	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	26053136	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28846666, 30301460, 32537767, 34235813, 35813663	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10982535, 10985497, 12454321, 12618085, 12915627, 14741073, 14988254, 15080783, 15277436, 15379752, 15632890, 15833936, 15882283, 16002077, 16389127, 16644712, 17004092, 17327459, 17332447, 17343862, 17426996, 18025402, 18401567, 18439548, 18551710, 18700811, 18852330, 19095725, 19712989, 19892791, 20400278, 20661421, 20716378, 21094359, 21149504, 21184785, 21270276, 21493817, 21519150, 21525158, 21700917, 21935671, 23274901, 23340375, 23708174, 23985808, 24203850, 24286720, 24582179, 25986660, 26578543, 26794963, 27003100, 27273455, 27298824, 27395328, 27450396, 27856516, 27955950, 28122172, 28403353, 28534431, 28569269, 28666597, 28759613, 28766758, 28780750, 28801571, 28809726, 28834086, 28853729, 29051034, 29254741, 29258216, 29281159, 29379005, 29390435, 29476733, 29657148, 29664664, 29739462, 29762755, 29777230, 29803192, 29851359, 29866373, 29895294, 29982147, 30026044, 30063013, 30077872, 30174285, 30179212, 30181854, 30191607, 30244088, 30361848, 30427060, 30553025, 30587667, 30592706, 30646836, 30660850, 30684651, 30685423, 30723056, 30824395, 30826804, 30895902, 30911344, 30947565, 30950561, 30959530, 31006835, 31093931, 31151433, 31154826, 31208420, 31321988, 31330062, 31371431, 31427179, 31434843, 31471378, 31473619, 31501920, 31581728, 31707846, 31768828, 31770616, 31772522, 31781724, 31814529, 31841043		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12690081, 18700811, 18852330, 19145248, 20587599, 20716378, 21149504, 21931794, 22056417, 23283045, 24197824, 27784852, 28801571, 29379005, 33028234, 37801334, 39284453	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	17261875, 18924263		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18285554, 18439548, 19130414, 21935671, 25104521, 27123454, 32265833, 33081810	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21900154	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12690081, 15774022, 18039190, 21029457, 21143859, 21937998, 23049543, 23172977, 23257395, 23760703, 24197824, 25587547, 25768928, 25887518, 28761062, 31015797, 31142858, 31471424, 32828613, 34161346, 34917685, 34931349, 35782064, 36387841, 37782172	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17189536, 18700811, 24182629, 24495560, 31471424	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34505161	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17906106, 18551710, 18853133, 20368232, 22801596, 26114833, 26487741, 27329016, 28222033, 28237858, 28640379, 29198994, 29320773, 29527782, 29808365, 30020457, 30619477, 30836628		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	20012460		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	20012460		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12147152, 12454321, 12618085, 12915627, 14988254, 15080783, 15105038, 15184288, 15277436, 15472203, 16189249, 17044846, 17189536, 17286233, 17327459, 17533210, 17537658, 17584094, 17665514, 17704300, 17900590, 18700811, 19488607, 19876063, 19892791, 20585974, 20716378, 21044752, 21262584, 21289263, 21756351, 21814873, 21935671, 22138970, 22787179, 23257395, 23643522, 24442509, 24636767, 24907704, 25768928, 25869607, 25887518, 26578543, 27190085, 27298824, 27771738, 27783183, 28042628, 28122172, 28178951, 28207876, 28284664, 28320383, 28393627, 28403353, 28413186, 28448891, 28479155, 28481339, 28534431, 28559532, 28645014, 28684396, 28685957, 28716139, 28733174, 28778482, 28789654, 28802226, 28834907, 28918492, 29016549, 29064626, 29104510, 29190710, 29204667, 29221802, 29246639, 29365333, 29415341, 29547051, 29572133, 29604155, 29694948, 29753585, 29951035, 29967793, 30077872, 30255491, 30313029, 30321669, 30348948, 30352748, 30423276, 30455330, 30460863, 30521849, 30619477, 30704070, 30799801, 30826600, 30833960, 30872696, 30894578, 30895902, 31142858, 31185304, 31208420, 31211997, 31225969, 31258707, 31263995, 31306866, 31321988, 31326727, 31471378, 31471424, 31477553, 31481105, 31485456, 31519281, 31572465, 31610512, 31804340, 31827375, 31846506		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	16681424, 17044846, 17499233		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	20012460		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	20012460		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	21519150		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	LHGDN	17934713		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	26953894		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35068329	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36626516, 36828641	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17286233, 29547051, 29805483, 30794428, 31511234, 31593848		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	19145248, 25887518		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	19145248, 25887518	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	CTD_human_DG	20012460		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29168186, 30278950		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27439595, 30033839		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	29512396		★☆☆☆☆ Found in Text Mining only
Disorders of Porphyrin Metabolism	Porphyria	BEFREE	12508966		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	19077177	Associate	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	21237193		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	28157735		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	27622361		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular disease	Pubtator	31930228	Associate	★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	27941316, 30932745, 31363467, 31712072		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	29349839		★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	29725335		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28486313, 30817584		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	34481527	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	17714716		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17885212, 18420210, 21459939, 22177994, 24474658, 27510601, 27917651, 28036158, 28222379, 29136770, 29311705, 29516281, 29721726, 29765452, 29993265, 30368730, 30535619, 30895902, 31456586, 31473619, 31835800		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	27633999, 30368730	Associate	★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	25363664, 28687081, 31546116		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	29293548		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	23940726, 29345041		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	27476619, 28179442, 30520087		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	25081498, 30636224, 31049785		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	28935853, 34386016	Associate	★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	29149510		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18383516, 26310275		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	CTD_human_DG	22248470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18055714		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18383516, 26310275	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39809220	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	31013508		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	27384530, 28992341, 31077531, 31574795		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37832065	Stimulate	★☆☆☆☆ Found in Text Mining only
ENDPLATE ACETYLCHOLINESTERASE DEFICIENCY (disorder)	Endplate acetylcholinesterase deficiency	BEFREE	31000214		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	26571220	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24732104	Associate	★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	25363664, 30756253, 31801620		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30368003, 30476270		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	29664657		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29415870, 30178473, 30273823, 31620066		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
EPILEPSY, PYRIDOXINE-DEPENDENT	Epilepsy	BEFREE	30168088		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	31206169		★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic ataxia	Pubtator	28875953	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19196186, 27516000		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	28514756, 30607764		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	27904146, 28135842, 28280316, 30976039, 31148390		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19801321, 20686879, 22911253, 24206575, 27839896, 28120093, 29202716, 30167922, 30396980, 30804146, 31512813		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19801321, 20686879, 22911253, 24206575, 28120093, 29202716, 30167922, 30396980, 30804146, 31512813		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	20686879, 27041792, 31646823	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17158147, 19282817, 22763479, 28837559, 29879880		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	17158147	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	26989902	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29033609		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	29225964		★☆☆☆☆ Found in Text Mining only
Extravasation of Diagnostic and Therapeutic Materials	Extravasation of diagnostic and therapeutic materials	Pubtator	31234798	Associate	★☆☆☆☆ Found in Text Mining only
Extravasation of Diagnostic and Therapeutic Materials	Extravasation of diagnostic and therapeutic materials	Pubtator	34260518	Stimulate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	18704199, 19692124, 27778189, 30154790		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	18172744		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	LHGDN	18172744		★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	BEFREE	31620889		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	17329916, 18300119	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	25088882, 33420772, 33576586	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	31759091	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21907687, 28073639, 28836350, 28929125, 30463312, 31235954		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	23697588	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	26256894	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28457061, 28760353, 28852433, 30472683, 31291245		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22333691, 25870985, 31009401, 31131678		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	28571565		★☆☆☆☆ Found in Text Mining only
Foot osteomyelitis	Foot osteomyelitis	BEFREE	26953894, 30685423		★☆☆☆☆ Found in Text Mining only
Frontonasal dysplasia	Frontonasal Dysplasia	BEFREE	30143887		★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	BEFREE	30101368		★☆☆☆☆ Found in Text Mining only
Funisitis (disorder)	Funisitis	BEFREE	27450900, 28780500		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28716660, 29205753		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	33907835	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	28682678, 30470845, 31653609		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30795853		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	30788040		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30768387		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	23778325	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28785142		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	24574805	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	28505469		★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	31277098, 31777354		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	18538409		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	19040303, 28138903, 28856429, 29236347, 29346621, 29680850, 31418104, 31507597, 31599690		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	31507597, 37534674	Associate	★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	28300459	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	21550586, 28036117, 29949223		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29513714, 30880204		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29513714	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29513714, 29696530, 30880204		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29460097, 31599129, 31665421		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	12571856, 21071964, 28320366		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	31059804		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	16723442, 25214719	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	18704199, 19692124, 27778189, 30288946		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	23331132	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	28445313		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	34373464	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28111964, 30249022		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	15547092, 19514647		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	23773925	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	25653477	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33498689	Stimulate	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	28693167		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29718547, 29805261, 31379477		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28506799, 28608943, 30628981		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34799942	Inhibit	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30484735		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	11857055, 12237169, 20157054, 22828776, 24410968, 30734265, 31063484, 31791637		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	14645206, 17388968	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	17388968		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27104679, 36005561	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	16360360		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	18387435, 26705751, 32378457	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19343415, 19587606, 20371666, 21220701, 21519150, 22875408, 23413906, 23861484, 26864064, 27384414, 27605566, 27730663, 28542263, 28684396, 28832572, 28883850, 29066436, 29169753, 29306896, 29382606, 29396658, 29627531, 29633232, 29685722, 29710336, 29771963, 29934374, 30427997, 30716591, 30773798, 30819375, 30853478, 31104823, 31220103, 31400725, 31596459, 31603935		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21089116, 22117908, 26515873, 26864064, 30006491, 33542341, 34191437, 35113419, 35197177, 36882679, 36966338	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	22117908	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	BEFREE	30114262		★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	16360360		★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	31023326, 31027170		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	28689896		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	37970725	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28133789, 28234665, 31821331		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	39394593	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	20016047	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	28880867	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	19850925, 33574979	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	19552682	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	19262552	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	21231959, 21269583, 29129626, 31343484, 31851146		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25027406, 32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	30810658, 8727711	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	30810658, 31962161, 32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	17663417, 31047837		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	22139496		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28270386	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	10217368, 23416122		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	27911007, 28769536, 30293125, 31253065, 31729595		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17063178, 25096510, 27734324, 27767372, 28430145, 29619872, 29717808		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17063178, 24364452, 24957738, 25096510, 27734324, 27767372, 28430145, 29619872, 29717808		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	24364452	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28458650, 30849754		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	31196585		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	26066391	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	15080783		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	26573997		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17702862, 22834788, 28847550, 29713239, 30249443, 31674218		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	LHGDN	18389332		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	25993353, 34386016	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	17359487, 18602518, 26229086, 26386212		★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	31302739		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	28168662, 7572989		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16370555, 20145925, 24776922, 27141013, 30191607, 31330062		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19936455	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	17158432, 29032752, 31493520		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	17158432	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	25897102	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	LHGDN	15798966		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21501070, 22177994, 27452659, 27798951, 29804482, 30084918, 30517727, 30733965		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29739462, 30130534, 30165364, 31014756		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	26340459		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	23789212	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	18602518, 26386212		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	CTD_human_DG	21350317		★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	28321403		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	12690081, 17827818, 18654021, 19965533, 21978028, 22848687, 37782172	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18574071, 21369372, 24029867, 25637629, 26114349, 26391130	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	35186226	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	28621587		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12690081, 15614032, 15731495, 17211240, 17426996, 17508011, 18339698, 18574071, 19056836, 19410251, 19587606, 19639050, 19712989, 20157054, 20383745, 21220701, 21270838, 22614460, 22763479, 22848687, 23046580, 23122314, 23358199, 23701472, 24055729, 24226100, 24671014, 24763700, 25537992, 25986660, 26066391, 26114349, 26167669, 27450396, 27477843, 27904146, 28071854, 28280316, 28356272, 28378496, 28666991, 28728620, 28837559, 28882065, 28982776, 28983603, 28994516, 29069022, 29101422, 29127717, 29143665, 29198994, 29221802, 29248973, 29321950, 29332485, 29335464, 29338684, 29390435, 29523566, 29657148, 29686318, 29712560, 29742267, 29846271, 29982147, 29987103, 30012869, 30299171, 30325241, 30386792, 30450976, 30479170, 30557057, 30560695, 30637771, 30640739, 30662999, 30700522, 30704070, 30834690, 30849754, 30872696, 30911344, 30982149, 31014756, 31091356, 31093927, 31235846, 31337127, 31396293, 31456586, 31481105, 31734276, 31765451, 31781724, 31800000, 31805418		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	14620923, 16680063, 19770776, 20667508		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15866055, 15920074, 18388037, 18654021		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28154166, 30496036, 30626765		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28154166, 30496036		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28185531, 29987103, 31521158, 31630099		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	33775186	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoadiponectinemia	Hypoadiponectinemia	BEFREE	27658341		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	16313263, 27230223, 27477843, 27966026, 28358923, 28837537, 29016317, 29457576, 29465542, 29541185, 30361848, 30535923, 30622779, 30982726, 31686344		★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	BEFREE	12701054		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	27856930, 29392554		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	39185088	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24659848	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37731495	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28741035, 31121634, 31812653		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28727824, 29491077, 31260491, 31272506		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	28985614, 30974772		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	27878344		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24330103, 30277869		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21882188, 22117501, 28122020, 29909421		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28122020, 29909421, 34386016	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36624433	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	19025118		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	11339241		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	29466790		★☆☆☆☆ Found in Text Mining only
Immune Complex Diseases	Immune Complex Diseases	BEFREE	19155486		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	27654215, 29310912		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	19155486, 30291762		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	20737202, 29484746		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27926762, 28199691, 29943722, 30625464		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	15851726, 17430245, 17490859, 17498578, 19590054, 20065134, 21915265, 22895578, 24305621, 24997674, 27788929, 27861706, 28416092, 28526765, 28694011, 29063513, 29108529, 29338747, 29451096, 29641605, 30190688, 30355213, 30364161, 30760633, 31083252, 31450022, 31493520, 31740754, 31808814		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	18191407, 18484169		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18828896	Associate	★☆☆☆☆ Found in Text Mining only
INFLAMMATORY BOWEL DISEASE 25, AUTOSOMAL RECESSIVE	Inflammatory Bowel Disease	BEFREE	30985701		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11843038, 12811429, 18566104, 23429464, 23598815, 25636121, 27001939, 27327646, 27622361, 27741061, 28040992, 28138990, 28169974, 28498155, 28498159, 28738231, 28902123, 29119722, 29233119, 29272479, 29426615, 29740978, 30006816, 30169521, 30321330, 30581331, 30734320, 30943854, 30981000, 30985701, 30994906, 31143074, 31148945, 31306343, 31455308, 31467814, 31772929, 31841064		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	20117339, 27001939, 32229654, 32840322, 37306210, 40224486	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23624446, 39487408	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18383516, 23116196, 26256894, 31877696, 32198016	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21143879, 26123797	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29349839		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	37553573	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	34635067	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	BEFREE	29254317		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28608943, 28945626, 28981082, 31092463		★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	29448936		★☆☆☆☆ Found in Text Mining only
Intrinsic Factor Deficiency	Intrinsic Factor Deficiency	BEFREE	30858961		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	28701106		★☆☆☆☆ Found in Text Mining only
Iron Metabolism Disorders	Iron metabolism disorder	Pubtator	37970725	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	16336444, 19000667, 31535426		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28040992, 28566121		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	37443809	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	16266402, 16733231, 16809555, 17355554, 18083122, 19262552, 19390179, 20145391, 20686879, 20733302, 22875596, 23980698, 24231564, 24636767, 24771073, 24989682, 26004291, 26063371, 26718567, 27050473, 27266621, 27448592, 27459905, 27460564, 27554116, 28287042, 28302952, 28456936, 28542069, 29081337, 29325799, 29451096, 29548857, 29556980, 29773576, 29869620, 29998802, 30056003, 30318492, 30718369, 30987691, 31127075, 31145464, 31520899, 31584351, 31692152, 31738143, 31770230		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	31257675, 31721299, 34970793, 35503943	Associate	★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	20016047		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	17075277, 27385219, 27562034, 28283733, 31655933, 31693652		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	28249975, 28321490, 28841913, 29927991, 30295521, 30418061, 30665833, 31447253		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10616846, 17286233, 21569369, 27665938, 28346363, 28378496		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17347578, 17598370, 19034331		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18300128, 31234798, 36657422	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29802078, 29912602, 31060892, 31429742		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15247979, 19965533, 21873362, 35366343	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18027444, 33672355, 34529688	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	20671226, 23535585, 24206243, 27470679, 28242291, 28433221, 28886014, 29058639, 29914404, 30069927, 30071826, 30168414, 30293924, 30298655, 30582197, 30672713, 30706372, 30971264, 31204773, 31317264, 31382219, 31620123, 31842300		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	17623721		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19539174		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	27877078, 29255356, 29330688, 29761287, 29926516, 30465136, 31049900, 31101015, 9767543		★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	29048943		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28243123		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19834334, 28301500, 30885221		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	21811191, 28443567, 29521061, 29633232		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	16360360		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29202702		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	29202702	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35614177	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	7628587		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	19820424		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	17160612, 20416971, 21316504, 21700657, 26838543, 30664912, 30840592, 30858961, 31277704, 31703096, 31752148, 31821331		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	17718048		★☆☆☆☆ Found in Text Mining only
Limbal stem cell deficiency	Limbal stem cell deficiency	BEFREE	30347185		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17435139, 28209200, 29287926		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	26572532, 31149766		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	35684160	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15539624, 16054696, 17004092, 17341888, 19054267, 21060154, 2170518, 23763486, 25027406, 26884882, 27448501, 28249358, 28350119, 28486226, 28521452, 28821164, 30025407, 30237725, 30259282, 30336489, 30486825, 31141535, 31418936, 8703909		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17341888, 17845537		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	15808312		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22333691, 28614777, 28840619, 29331339, 29658815, 29691168, 29861471, 29972862, 30363905, 30810658, 31486016, 31530418, 31539885, 31582968		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28467457	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	27079922	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	27708384		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	33356606	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	33573054	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28272093		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15539624, 16054696, 17004092, 21060154, 2170518, 8703909		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17245735, 20074254, 20920231, 39298399	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	18591402		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24696530, 34486706, 36555850, 36941690	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26703241, 30387311, 30416990, 31506089		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	27906425, 31841044, 32168865, 34386016, 38221627, 39908093	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32319118, 33080140, 39298399	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28103926, 28352064, 29052023, 29596687, 29901591, 30702600, 31436584, 31554007		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	28670246, 28902919		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16117833	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16698114		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17114654		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23364973, 24633920, 25105437, 25422226, 25999661, 26264146, 27230571, 31142628, 38063002	Associate	★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	29675623		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12571856, 12794828, 20434119, 24574329, 28286229		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	14645206, 18216863, 18793001, 19950271, 20434119, 23331132, 24574329, 32146614, 33584722, 33787566, 34101055, 34134452, 34611064, 35418986, 35690780, 36706536, 38159527	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29316941	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12571856, 12794828, 20434119, 24574329		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11857055, 12571856, 12794828, 14645206, 15797975, 16441262, 17096343, 17596285, 18182444, 18216863, 18373721, 18793001, 19155486, 19755616, 20434119, 21468143, 21984763, 23397258, 24574329, 26861134, 27531690, 27863333, 28063160, 28257596, 28286229, 28352058, 28567557, 28688058, 28823196, 28840341, 28862243, 29546774, 29550813, 29776017, 29779437, 30112073, 30282476, 30539580, 30603640, 30661452, 30712491, 30847312, 30941928, 30994732, 31092489, 31130368, 31415387, 31763930, 31811237, 31812331, 3593435		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17596285, 18182444, 18793001		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	17718048		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	12571856, 17596285, 28300543, 28566480, 30941928		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	12571856, 23331132, 37545739	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	18852001		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12571856, 12794828, 20434119, 24574329		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20686879, 24633920, 26310275, 29385406, 31142628	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28869447, 29411124		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30461623		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30736822	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	26554525, 27832364, 30676833, 31540339		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	17079491, 17293598, 17339482, 17675241, 18704199, 19077177, 26330749, 26961257, 27376713, 30013157, 30154790	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	18538409, 20346514, 21633121, 33364081	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular degeneration	Macular Degeneration	BEFREE	18786923, 20346514		★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	28676350		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22683764, 22832853, 26122587, 26895280, 27702411, 28187400, 28257825, 28262603, 28509904, 28710952, 28800269, 28867280, 28867283, 29049554, 29069253, 29156363, 29246639, 29298663, 29427582, 29529546, 29764522, 29787958, 29871707, 29895893, 29935756, 30102967, 30126458, 30249443, 30311809, 30699847, 30762747, 30819515, 30878656, 30899619, 31075818, 31306866, 31354538, 31604141, 31676465, 31683271, 31800914		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22683764, 22832853		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30484735		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	29301121		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24336325		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11241275, 20727736, 21496483, 23627410, 23955082, 23991131, 24036889, 24835491, 25339205, 26130675, 26310275, 27780363, 27914795, 28042070, 28292922, 28489884, 28559409, 28617135, 28641369, 28846105, 28983080, 29178353, 29668832, 29921457, 29974464, 30293230, 30962499, 31138314, 31182704, 31186728, 31443226, 31454519, 31642812		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	18383516, 26310275		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17103073, 19801321, 20686879, 22911253, 24206575, 28120093, 29202716, 30167922, 30396980, 30804146, 31512813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28716660, 29205753		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	26095694, 28684736, 28850803		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30046933		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17114654, 18402527, 20421535, 20727736, 23254959, 24139238, 24633920, 25422226, 25999661, 27230571, 27785660, 28199511, 28472743, 28577953, 28981818, 29851300, 29941786, 30078713, 30113495, 30297515, 30521079, 30558004, 30606716, 31142628, 31559588, 31565153, 31579619, 31668096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17114654		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17435139, 28209200		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	30226795		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28834887, 28935270, 30046933, 31462430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27984485, 29653723, 30844662, 31464604, 31632137, 31662540, 31685562, 31717722		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11445006, 12932305, 16989575, 17114654, 17975004, 19055846, 19189403, 19267250, 19436291, 24844401, 28160568, 28423553, 29322512, 29663110, 30450757, 31521528, 31583707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29344182, 29491721, 31129241, 31384611, 31766266		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10469042, 15456743, 17103073, 17114654, 17341888, 20056955, 20727736, 21737650, 22159575, 23627410, 24246360, 24761881, 24835491, 25025473, 25864110, 26860264, 26912098, 27516000, 27539314, 27595291, 27864665, 27866811, 28064398, 28069031, 28209200, 28247043, 28320465, 28327451, 28393357, 28441374, 28472743, 28489884, 28504925, 28514756, 28759130, 28864369, 29197366, 29258216, 29270656, 29309374, 29344688, 29379005, 29475966, 29488212, 29534089, 29577260, 29596361, 29718222, 29788156, 30019304, 30025407, 30056387, 30097610, 30278950, 30288654, 30338797, 30396977, 30408622, 30450976, 30583963, 30612115, 30628094, 30760246, 30802456, 30844662, 30878797, 31015558, 31023832, 31104823, 31339853, 31414667, 31473619, 31486619, 31504409, 31521117, 31528313, 31540620, 31587105, 31701522, 31780028, 31824195, 9642683		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21737650, 28901315, 29126926		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19077918, 20949557, 22394005, 26628300, 29246519, 29779798, 31622379		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	15882283, 27860223, 28099511, 28673686, 29983232, 30450976, 31377013, 31400092, 31566916, 31751531		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	17132891, 35113419	Associate	★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	9337397		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	28645055, 29902794		★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	11361219		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29301121		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	31177139		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	18439548, 20724646, 21700917, 23760703, 30181854, 30455330		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	29935756		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25779565, 29808365, 30607764		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27879288, 30450100, 32303612, 37258039	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19433520, 19796676, 19892791, 20836906, 20955778, 21296145, 22580182, 23277135, 24246360, 25603415, 25683698, 26846364, 26895280, 27384414, 27562420, 27816325, 28000423, 28128231, 28135632, 28152396, 28181636, 28183031, 28187400, 28257825, 28318471, 28419913, 28501736, 28558901, 28600633, 28645055, 28701268, 28704763, 28867280, 28867283, 28916991, 29016549, 29028592, 29156363, 29196383, 29218020, 29237576, 29303703, 29340226, 29422922, 29489077, 29518064, 29550676, 29575958, 29654412, 29721726, 29787958, 29849779, 29895893, 29928963, 29979617, 30048584, 30097134, 30098513, 30102967, 30104698, 30126458, 30172071, 30182258, 30389462, 30394311, 30405261, 30426235, 30521079, 30581212, 30624288, 30760746, 30819515, 30822466, 30854996, 30886334, 30899619, 30955108, 30958417, 31022775, 31109116, 31258105, 31267614, 31319037, 31377557, 31479683, 31615595, 31665233, 31707310, 31711279, 31823093		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28505469, 28645055, 28694011, 29028592, 29088880, 30439824, 30768387, 31284079, 31306866		★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	BEFREE	28645055		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	16822830, 17537658, 21447704, 24997674, 27977503, 28801589, 30252104, 30597323, 31784329		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	16840032, 25993353, 34348131, 35457174	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	18414778		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	CTD_human_DG	19131468		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30945673	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18285551, 18439548, 20016051, 21296145, 21674002, 21918574, 26864064, 29670915, 33669862, 35684100	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19936455, 21122062, 24564178, 29068430, 30383538	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	12551862, 12761670, 15289378, 16189249, 16325697, 16456090, 16670163, 17211240, 17634253, 18160463, 18285551, 18439548, 18640391, 19074515, 19410251, 19488607, 20494378, 20585974, 21205020, 21296145, 21357282, 21674002, 21918574, 22178353, 22354267, 22855337, 23144745, 23170936, 23360434, 23399350, 23985808, 24055729, 25536316, 25587758, 25869607, 26771691, 26864064, 27083758, 27524803, 27539098, 27813377, 28040302, 28077381, 28222379, 28241426, 28245894, 28280316, 28350403, 28382609, 28475745, 28537577, 28586387, 28598231, 28654149, 28685581, 28710952, 28764912, 28799434, 28834907, 28885336, 28912780, 28917193, 28943332, 28994516, 29022500, 29037330, 29051034, 29068430, 29077157, 29156363, 29223110, 29321950, 29367725, 29382113, 29392970, 29445240, 29488212, 29609563, 29688806, 29778547, 29851359, 29871707, 29907916, 29941395, 29948970, 29954070, 29960588, 29975666, 29976096, 30184563, 30190688, 30248505, 30348591, 30383538, 30426122, 30450757, 30454030, 30581334, 30662999, 30916180, 30935704, 31091356, 31118157, 31177066, 31229566, 31373727, 31473619, 31676465, 31688897, 31734276, 31752150, 31826385		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	16644639		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	17449131		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31180164		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	25286759		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	LHGDN	18226363		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	23643286	Associate	★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	27663770	Stimulate	★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	30502363		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28677995, 29938621, 30645751, 30840223, 30862180, 30961918, 31758522		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	30862180		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22008268, 27915992		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	18676019		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	23861188		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28183031, 29408464, 31188735		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	27914145		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	27816667, 28965957, 29544672, 30430941, 31676465		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29937423	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	31462430		★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	22146561		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18071779, 18710885		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	18710885, 25266886, 28526535, 28915665, 28950425, 29171205, 29755710, 29948255, 30454066, 30572858, 31074226, 31275907, 31302740, 31612117, 31680036, 31734766		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	27806720, 32976897, 33215440, 37820655	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15359986, 19259613, 29131152, 29233917, 30202676		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23575330, 36604748	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23861188, 24008605, 26920376, 27831647, 29107207, 30014875, 30182258		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29854799	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	36762734	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29372410		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11987244		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	21173097		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	31331448		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	21173097	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	16360360		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10456448, 10634818, 12534452, 12801611, 12975538, 14644408, 15262177, 16176166, 16210572, 16266402, 16313298, 16565153, 16630992, 16684835, 17002900, 17561469, 17697822, 17956875, 17981284, 18772067, 18823504, 19628406, 20131929, 20467232, 20580041, 20852043, 21362767, 21406102, 21493817, 22017383, 23046580, 23284892, 24010569, 25781951, 25938632, 26658659, 27979879, 28166784, 28181636, 28229159, 28391888, 28475685, 28490621, 28491088, 28642677, 28673897, 28685248, 28748762, 28794619, 28913846, 28946036, 29049804, 29181692, 29227024, 29247528, 29274325, 29331485, 29453330, 29544958, 29547707, 29759006, 29773576, 30121016, 30138917, 30297597, 30354651, 30371339, 30474426, 30738244, 30824395, 31010048, 31063484, 31140334, 31140583, 31358306, 31387982, 31411090, 31826385		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12819031, 12835218, 15894827, 17706955, 18296838, 18394761, 19130414		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	15670033, 19130414, 21406102, 26658659, 33081810	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17561469, 18439548, 32515246	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	10721674, 12563060, 14606608, 14645206, 18971492, 19652664, 21362767, 21848660, 23926208, 25411050, 29515239, 30364730, 31063484, 31828049		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	11840375		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	18971492, 21143859	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial necrosis	Myocardial necrosis	BEFREE	27979879, 28642677, 28748762, 30297597		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	19343415, 28064233, 30017519, 30599763, 31105785		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	CTD_human_DG	20361910		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	16452363, 29436842, 30684913		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	24197824, 30845774	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	37199165	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	28766758		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	16944669		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	11179352	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25482300, 28676731, 28707462, 29137033, 29808625, 30270098, 30847301		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	28533443	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	30027466		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	25665053, 27745748, 29311572, 29557695, 30027466, 30431380, 30635129, 31703096		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11420696, 15456743, 16221209, 19187582, 19801321, 20357450, 21737650, 22699780, 22911253, 24187458, 25025473, 25480691, 25864110, 26735530, 27495385, 27793524, 27814274, 28186864, 28209200, 28431566, 28489884, 28514756, 28521452, 28693795, 28707462, 28727824, 28846105, 28851415, 29027398, 29076939, 29198007, 29287926, 29290765, 29348549, 29385406, 29428866, 29434730, 29485416, 29742284, 29879960, 30113495, 30166353, 30213543, 30235009, 30273860, 30288654, 30336489, 30450976, 30607764, 30788040, 31196200, 31234146, 31300050, 31311108, 31462430, 31487965, 31537484, 31749214, 31777551		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31655933		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	CTD_human_DG	17014549		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	CTD_human_DG	17014549		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30230959		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31057478, 31664120		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23763486		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	31283835		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15286457, 29892284, 29951057		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28549057		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29107207		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	28823196		★☆☆☆☆ Found in Text Mining only
Neurotic Disorders	Neurotic Disorders	BEFREE	29544672		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	24735719, 27738972, 30358412, 31089183		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	21316504, 26838543, 30858961, 31277704, 31703096, 31752148, 31821331		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	31727123	Stimulate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	25935436, 26244337, 26554525, 28057433, 28375580, 28493349, 29130957, 29678705, 30525744		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	28676731		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	20579864, 20625834, 22333691, 23274901, 23985808, 27737498, 27825671, 28234943, 28637594, 28732187, 28759939, 28796299, 29159396, 29222767, 29281159, 30001365, 30113661, 30246507, 30325458, 30372496, 30460863, 30576537, 31680281, 31688897, 31706905		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20686879, 21430404, 24625581, 25335739, 26088452, 27659598, 27853867, 28199511, 28382136, 28419722, 28472787, 28485168, 29549910, 29715162, 30018308, 30113495, 30178541, 30212928, 30232703, 30410356, 30952767, 31022775, 31148582, 31261584, 31579619		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25474087, 28760353		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29703661, 30190688, 30394240, 30414721, 30905124, 30967316		★☆☆☆☆ Found in Text Mining only
Normocytic anemia	Anemia	BEFREE	30850153		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11448405, 12690081, 12915627, 15080783, 15184288, 15364812, 15472203, 16493118, 16840032, 17704300, 17878255, 18383516, 18571785, 18573495, 18700811, 18931036, 18991689, 19101671, 19238141, 19238807, 19369430, 19760027, 20856253, 21195701, 21324310, 21778217, 21790705, 22178353, 23360434, 24582179, 24599720, 25411050, 26578543, 27346320, 27643980, 27702831, 27853845, 28000423, 28036158, 28103807, 28128231, 28194004, 28280316, 28371297, 28393498, 28396407, 28409494, 28504712, 28513060, 28615263, 28666597, 28757528, 28818242, 28848164, 28994516, 29033897, 29051034, 29070829, 29148260, 29174028, 29222885, 29258216, 29415341, 29550676, 29910808, 29951035, 29975666, 30015514, 30141234, 30174020, 30248505, 30255491, 30321217, 30439985, 30450993, 30617082, 30704070, 30728031, 30872696, 30895509, 30895902, 30903427, 30909605, 31012350, 31071114, 31138314, 31174304, 31177066, 31314878, 31343076, 31477553, 31688081, 31737180, 31752150, 31763930, 31780025, 31784329, 31785398, 31787367		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16840032, 18262644, 18931036, 21901025, 22722675, 24197824, 25186264, 25838943, 26123797, 26147062, 28103807, 30009507, 30572569, 30845774, 30900134, 31649216, 32443557, 33624438, 37801334	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18383516, 19238141, 19760027, 21029470, 21203453, 21778217, 21790705, 21937998, 21979869, 22056417, 22193922, 22492993, 23049543, 24901842, 25393688, 25448795, 25827033, 25993353, 27643980, 28746203, 29049554, 29802748, 30658193, 30704070, 32176045, 32214403, 32398726, 32809874, 32928877, 34448000, 34507654, 35712257, 36206635, 36273209, 37463688, 37493001, 37960189, 40015263, 40243681	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	24042701		★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	20463091, 28103807	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	27507606	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	37266430	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	19820018, 22178353, 27507606, 28393498, 29051034, 29664665, 30131311, 31776403		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	30646251	Stimulate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1A	Oculocutaneous albinism	BEFREE	12594844		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	30760894		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	28444539, 28770703, 31803551		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	30226795		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18291686	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19036615, 28112376, 28912428	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	29128509, 40211184	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	34073132	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27327646, 27546883, 27588353, 28128478, 29351749, 29758352, 30908508		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	18043449, 19820424, 26634954, 26953894, 28992868, 29620718, 30520802, 30953392, 31268423, 31386641, 31477357		★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	24530824, 30304126		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	24315820, 28975973, 30179212, 30651805		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21978922, 29138578, 30873755		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22628227	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	27943617		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	31122524		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18245530		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24364468, 28834887, 28935270, 31462430		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20713982	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27513230, 30065196, 31766991	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27984485, 29653723, 30844662, 31464604, 31632137, 31662540, 31685562, 31717722		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28859917, 30632282, 30974894		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32867211	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	18953261		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28536603, 30636224		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	32787347	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34386016, 37910111	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	28431197, 28746189		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	14617305, 18550640, 29253109		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	27510423, 28146444, 28736033		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26911448, 34386016, 35593028	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29016447, 29107207, 29572994, 29951057, 29980980, 30185816, 30353300, 30390673, 31057478, 31693246		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	18048420, 22241816, 28160962, 29298330, 29478023, 30463062, 30732173, 31673927, 9848794		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	25711952		★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	26864064	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	30230959, 30632282		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	15547092, 19514647		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	20156355		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	18314113	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	25748492, 30394169		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	30772126, 30868443, 31610707		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	30053245		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	35658515	Stimulate	★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	39824289	Associate	★☆☆☆☆ Found in Text Mining only
Pericementitis	Pericementitis	CTD_human_DG	20011938		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	17763921		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	21550586, 27734498, 28858105, 29516504, 29520828, 29949223		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	34847238	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15777561, 16413242, 20618548, 21057970, 21682549, 23592000, 24494816, 26348353, 28332718, 28732187, 29163429, 29500831, 30124222, 30903199, 31125449, 31343076		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	CTD_human_DG	20011938		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	21545652, 24782175, 26241961, 26348353, 28732187, 32215496	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	30124222, 30777536	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	16443741, 25095746, 40731833	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	19778662, 20638228, 24795153, 39863282	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	16443741, 17671730, 18325332, 19778662, 27301335, 27734498, 28631078, 28666597, 28666785, 28789654, 29366990, 29805542, 30773823, 30824395, 30924393, 30948779, 31349820, 31477553		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28666785, 28789654, 31477553		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30911944		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	31781662	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30911944		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	30824395, 30924393, 30948779		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	30800122	Stimulate	★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	29544672		★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	31492166		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	18637714	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	19048456		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	27510423		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	31479683		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28196360, 28797003, 28864369, 30470216, 30868443, 31215423, 31519617		★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	31577714, 31718710		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15080783, 22553983, 23257395, 23375040, 27425379, 27838846, 28404960, 28598285, 28678568, 28836404, 28900795, 28953677, 29498342, 29631598, 30206805, 30256077, 30335612, 30339716, 30368447, 30475222, 31023609, 31053754, 31399035, 31461765, 31496906, 31519403, 31586179, 31608014, 31780025		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	15579759, 18206145, 19172699		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23127112, 23898913, 23981122, 28900795, 31705013, 32140727, 35768803, 35861921, 37181037, 40243681	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23257395, 25268995, 25467041, 26123797, 26589977, 34836180	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21173097, 28228104		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	21173097, 26225646, 28228104	Associate	★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	31507597	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	28103926		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	19077918		★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	21848660		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	23709344, 25827033, 27510423, 28135632, 28521179, 28676988, 28778657, 28851339, 28867284, 28994516, 30076980, 30127754, 30199144, 30653780, 30872092, 31306866		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	27815684, 29093565		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	22193922, 29975666		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	30325733, 31323005		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25053723, 25323314, 27979879, 28359413, 29622507, 30114262, 30205301, 30819375, 31064214, 31154826		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	29994968		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16854501, 17158432, 17540481, 19245412, 21116047, 22213409, 22895578, 26725994, 27861706, 28159467, 29016447, 29273039, 29451096, 30863888		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	4085162		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	31101112		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29372410		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	15756215		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	29654412		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30390673		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11445006, 12932305, 16989575, 17114654, 17975004, 19055846, 19189403, 19267250, 19436291, 24844401, 28160568, 28423553, 29322512, 29663110, 30450757, 31521528, 31583707		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12932305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18428198		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19189403, 19436291, 20576793, 22430136, 22859398, 24844401, 35286517	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	33843169, 36657422	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	30771700		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	CTD_human_DG	12559600		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21773944, 21848462, 22679307, 25234663, 27068801, 27401209, 28493493, 28586166, 28932021, 28947858, 28965564, 29068430, 29102940, 29302829, 29397035, 29656791, 29703851, 29723366, 29740978, 29937564, 29961691, 30198145, 30363704, 30654308, 30735527, 30844468, 30871045, 31070869, 31421033, 31767465, 31803954		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	29068430	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	29027583, 29937564		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24495605, 29544672, 29703661, 29778547, 30190688, 30394240, 30414721, 30905124, 30967316, 31676465		★☆☆☆☆ Found in Text Mining only
Psychotic episodes	Psychosis	BEFREE	30364161		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16971405, 19480658, 20595148, 23267696, 24078777, 24884805, 27799762, 27994452, 28476471, 28744116, 29386890, 31564851, 31695352, 32000766, 33964910, 35024012, 35186226, 37447386, 37978492, 38412768, 39780163	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18006888, 19272152, 20500811, 22071714, 23801879, 25709430, 26357470, 26922686, 30655663, 30880945, 31503552	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	35216582	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28610627, 30058599		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	29754456		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21882188		★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	30858847		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	12559600		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	31277098		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	28197938, 29068146, 29292666, 31027378		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	10543406, 21627560, 28558744, 4085162		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20949557, 25025473, 28273409, 28394749, 28982904, 30288654, 31129752		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	20949557		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	31803551		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	28558901, 30405261		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	1555039, 18504279, 25359432, 28681656, 29353098, 30729371		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	11339241		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16221209, 27255479, 28624829, 28875953, 29080691, 30213543, 31263677, 31311108, 31644587, 31723229		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16221209		★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	29912602		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	12951283, 29321950, 29912602, 30012497, 30496131, 30717116, 31446184		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	LHGDN	18078625		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29914404, 30558840, 30987877		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	29425066		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	32780727	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	34925324	Stimulate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	35310200, 35775463	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	28035549, 31739853		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29091568		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa Concentric	Retinitis pigmentosa	Pubtator	26783014	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31266060		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	31266060	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16406300		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10403281, 10531075, 10880057, 10990219, 11156544, 11361219, 11930657, 12455815, 12697270, 12846052, 14985107, 14994389, 15325803, 1555039, 15565336, 16406300, 16507115, 16820934, 17262825, 17568789, 17599731, 18418600, 18504279, 18930989, 19283524, 19827168, 19950324, 20031469, 20141484, 20441874, 20477882, 20858143, 20877716, 21459939, 21468143, 21627560, 21645266, 21921097, 21923740, 22183962, 22267327, 22302395, 22740142, 23244167, 23343469, 23517397, 23585841, 23660425, 23773307, 23856797, 24315820, 24549174, 25179377, 25359150, 25359432, 25623518, 25817699, 25889630, 26226010, 26241881, 26843177, 27125521, 27274008, 27342458, 27534721, 27722971, 27749227, 27778459, 27782866, 27858176, 2786697, 27992958, 28070931, 28072726, 28081709, 28087832, 28205390, 28207326, 28212115, 28279841, 28352064, 28393498, 28410854, 28425837, 28445313, 28490617, 28509333, 28524646, 28534075, 28676350, 28681656, 28701065, 28756710, 28766758, 28782994, 28817201, 28831245, 28832684, 28834907, 28850308, 28853601, 28894708, 28901727, 28936606, 28940139, 28950430, 28956118, 28980908, 29054755, 29065903, 29080328, 29101675, 29228799, 29259607, 29315763, 29341486, 29353098, 29408170, 29464314, 29481721, 29520264, 29520783, 29540200, 29588576, 29589156, 29611628, 29615411, 29621504, 29636082, 29644482, 29656372, 29656791, 29657146, 29676517, 29718222, 29720221, 29744553, 29776017, 29855349, 29882440, 29995999, 30008151, 30116727, 30123796, 30124222, 30132973, 30173151, 30177313, 30299246, 30358109, 30420853, 30431436, 30482075, 30506510, 30551438, 30590784, 30596097, 30658685, 30659089, 30677239, 30721294, 30729371, 30764871, 30777458, 30892482, 30911944, 31019190, 31130368, 31170172, 31240388, 31324694, 31348241, 31353421, 31358361, 31393198, 31396686, 31422723, 31451934, 31463666, 31522318, 31594926, 31620864, 31654331, 31665107, 31672633, 31736958, 31820713, 31838638, 31843000, 7633794, 8877916, 9572640		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	1568518		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15859024, 17763921, 18078625, 18573197, 18983663		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	29227024		★☆☆☆☆ Found in Text Mining only
Right ventricular failure	Ventricular Failure	BEFREE	31023326, 31027170		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	30889153	Associate	★☆☆☆☆ Found in Text Mining only
Ruptured Appendicitis	Appendicitis	BEFREE	30723978		★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	24532142, 26313358, 28087505, 28610765, 29373733, 30625261, 30768617, 31025925, 31119417, 31813637		★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	Pubtator	28632339, 30768617	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	29535705, 29569857, 31070869		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	30632406		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28727824, 29228679, 29491077, 30607764, 31260491, 31272506		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	30378742, 39369663	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37960189, 40162588	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17490859, 19619902, 21182750, 23996346, 24565000, 25781172, 26122587, 27327646, 27349652, 27622678, 27654215, 27744125, 28174109, 28416092, 28645055, 28917193, 28928004, 29028592, 29088880, 29094161, 29306175, 29310912, 29357805, 29464976, 29723719, 30190688, 30212728, 30273893, 30315442, 30364161, 30388399, 30905124, 30967316, 31118157, 31214940, 31284882, 31450022, 31504541, 31504969, 31571879, 31590005, 31676465		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	17490859, 19619902, 21182750		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	23996346, 25781172, 32919410, 37075652	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	27327646, 29094161, 35027554, 35385317, 37659117	Associate	★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	29897140		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	39991159	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	31674218	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	27868463		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27738330, 30149986, 30486767		★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	31053293		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15286457, 17430245, 21831326		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	20929576, 26125767, 29379005, 34769069, 35295285	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	21048935, 39948564	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10049985, 15795363, 19152691, 20552244, 22868808, 22968487, 23108494, 24833564, 26055687, 26339334, 26496101, 27139197, 27592234, 27594414, 27648690, 27767365, 27815684, 27823951, 27939333, 28076309, 28079172, 28087409, 28135842, 28155332, 28167245, 28177877, 28179407, 28196391, 28249358, 28258453, 28454850, 28471985, 28504925, 28680349, 28714582, 28727802, 28735154, 28741035, 28764651, 28824010, 28860348, 28875483, 28891027, 28898742, 28956241, 29055117, 29129626, 29176018, 29320362, 29379005, 29382319, 29383956, 29438222, 29540199, 29562917, 29577181, 29605824, 29671364, 29717808, 29731821, 29756282, 29760745, 29886794, 29895470, 29959455, 30004393, 30010061, 30012383, 30048858, 30068303, 30142533, 30186449, 30207217, 30332466, 30334408, 30411670, 30417415, 30446841, 30509228, 30547887, 30623257, 30633182, 30656987, 30672312, 30721450, 30760225, 30771742, 30772386, 30805753, 30811475, 30858952, 30926891, 30954003, 30956276, 30985959, 31015272, 31125901, 31214930, 31221548, 31258707, 31275752, 31305070, 31309103, 31323346, 31401614, 31446489, 31470804, 31486619, 31584643, 31589562, 31635838, 31651475, 31687850, 31806239		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	30182258		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	28513060, 31770616		★☆☆☆☆ Found in Text Mining only
Simple Endometrial Hyperplasia	Endometrial Hyperplasia	CTD_human_DG	22248470		★☆☆☆☆ Found in Text Mining only
Sinus Tachycardia	Sinus Tachycardia	BEFREE	29437733		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29923220	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	22159575		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	20141484, 22505177, 24315820, 28207326, 28524646, 29520264, 31594926		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	31718710		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	20538960, 22077067, 24380782, 25237185, 30001365, 31210414, 32210181, 33378050, 37217113	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	24293770, 35652886	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	29777230		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	28467884		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	18365276, 18685607		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	20538960, 22077067, 23345934, 24380782, 27323094, 27586389, 27600660, 28150280, 28215234, 28271327, 28432036, 28489776, 28683800, 28982776, 29042934, 29152745, 29202829, 29302924, 29482817, 29493039, 29522771, 29609563, 29740686, 29991422, 30001365, 30789791, 30908094, 31089857, 31210414, 31688081		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	25363664, 28687081, 29385150, 30300238, 30789791, 31546116		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30081009		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25996920, 30018308, 30555261		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25996920	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28121629	Stimulate	★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	20016047, 31151091		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 11	Spinocerebellar ataxia	Pubtator	29619129	Associate	★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	29451096		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	27390225, 27817204, 27863065, 28445313, 28544533, 28661926, 29703851, 30572513, 30646942, 30947732		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	28632339, 30768617, 32311164, 33204218	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12637157		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20421535, 22159575, 28716471, 30364985		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19495883, 22154084, 23212764, 23224754, 28819381, 28968977, 29776344, 30258731, 30396980, 31379941, 31471746, 31533862		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18006755, 29385406	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	30952746		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18006755, 18225580		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	29259311		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29385406		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	BEFREE	31504409		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	27832202, 27988513, 28055283, 28128312, 28277782, 28826799, 28883850, 29095267, 29375221, 29620476, 29655951, 29769425, 30138917, 30293924, 30344063, 30706372, 30737841, 30835559, 30924312, 31764795, 31779200		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	14996590, 16409458, 20346059, 23157807, 24709882, 29789902		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18571785, 21907687, 25474087, 28073639, 28760353, 28836350, 28929125, 30229840, 30463312, 31235954, 31706905		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28727824, 29491077, 31260491, 31272506		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29344182, 29491721, 31129241, 31384611, 31766266		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35566209, 36158129	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18439548	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	20962444, 21499712, 26718567, 28181636, 29081337, 34931349, 40135578	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27430874, 27815684, 28229304, 29683965, 29959259, 30116336, 30314920, 30317466, 30849754, 31317264		★☆☆☆☆ Found in Text Mining only
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	31292885		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28506639		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	34045476	Stimulate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	27938816		★☆☆☆☆ Found in Text Mining only
Synovial Hypertrophy	Synovial Hypertrophy	BEFREE	30173153		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	17918786, 28212115, 28621703, 28681656, 29848348, 29995999, 30756253, 30764871, 30824919, 30835943, 31396686, 31566238		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	30835943	Stimulate	★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	23941472, 27825177, 28667188		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	15797972, 22586157, 23397258, 28036158, 28639412, 28766758, 29790215, 30024658, 30277869, 31317426, 31436584, 31791379		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	18333373		★☆☆☆☆ Found in Text Mining only
Tachycardia Ventricular	Ventricular tachycardia	Pubtator	26864064	Associate	★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	24894103, 27816980, 27989502, 28856429, 28968895, 29024426, 30590495, 30792377, 31270281		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	29849849		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	29111402		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	23905873	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	29232169		★☆☆☆☆ Found in Text Mining only
Thalassemia Minor	Thalassemia	BEFREE	30865135		★☆☆☆☆ Found in Text Mining only
Thiopurine S methyltranferase deficiency	Thiopurine s-methyltransferase deficiency	Pubtator	36775960	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	21173097, 28228104	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	21173097, 28228104		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	17762621, 27984485, 29236347, 30795883, 31263677		★☆☆☆☆ Found in Text Mining only
Thromboembolic stroke	Thromboembolic stroke	BEFREE	28498565		★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	28498565	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	15497022, 16409458, 28880867, 37390087	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	16409458, 31023609		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	11238052, 15304023, 20874781, 25657311, 26225646, 28228104	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	15247979, 20351310, 21173097	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	30858847		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25653477		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	30683112	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	30101044		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	28490617		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	29897140		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	17355554, 30318492		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	17355554, 30318492, 30683618		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	LHGDN	17355554		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	30368447, 30569662		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	30234900		★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	30993467		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	21848660		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12811429, 18566104, 22374925, 25208103, 25636121, 26026389, 27488327, 27741061, 27771345, 27906804, 28830726, 29109300, 29112087, 29232715, 29335491, 29987967, 30165638, 30281832, 30558634, 30587439, 30628981, 30650133, 30650312, 30734233, 30906319, 31083541, 31204414, 31411363, 31498278, 31499013, 31613959, 31640916		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18566104		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	22683764, 22832853		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28187400, 28257825, 28509904, 29156363, 29246639, 29427582, 29787958, 30102967, 30249443, 30699847, 30819515, 30878656, 31676465, 31800914		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	29257244		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34541834	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	21109514, 28351163, 29254299, 30026764, 30206455		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	23207551, 24490166	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28901315	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	11914210	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	27095091, 28366648, 30411142, 31697216		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12665485, 15876843, 17158432, 18439548, 18971492, 19228486, 19834334, 20716378, 24808639, 29931542, 31584351		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	12934049, 15996056, 18971492		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	14688701, 17158432, 18439548, 18971492, 20716378, 22267767, 24997674, 25448795, 32639518, 40617584	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19620133, 30572569	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	22267767, 26667361	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	36005561	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	25879749	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	28856429, 28864843, 31531005, 31665468		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	39186910	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	31059846		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	15304023, 19690336, 25879749, 29474368, 37192419, 37762110	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	20874781, 27270163	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	24243751, 26864064		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	26864064		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	26864064	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	30961628		★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	BEFREE	30810594		★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	29306986		★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	34386016	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	22973867, 26842430, 28615251, 29203653		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	12454321, 27975188, 28052885, 29118583, 29227024, 30097651, 30352748, 30651805, 31020672, 31385179		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	35579027	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	39796549	Stimulate	★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 2	Von willebrand disorder	Pubtator	29976235	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	19362968		★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	32624019	Associate	★☆☆☆☆ Found in Text Mining only