Gene Gene information from NCBI Gene database.
Entrez ID 146434
Gene name Zinc finger protein 597
Gene symbol ZNF597
Synonyms (NCBI Gene)
HIT-4
Chromosome 16
Chromosome location 16p13.3
Summary This gene encodes a protein with multiple zinc finger domains. Loss of the related gene in rodents results in defects in neural development and embryonic lethality in mutant homozygotes. This gene is adjacent to a differentially methylated region (DMR) an
miRNA miRNA information provided by mirtarbase database.
45
miRTarBase ID miRNA Experiments Reference
MIRT018782 hsa-miR-335-5p Microarray 18185580
MIRT711103 hsa-miR-181a-5p HITS-CLIP 19536157
MIRT711102 hsa-miR-181b-5p HITS-CLIP 19536157
MIRT711101 hsa-miR-181c-5p HITS-CLIP 19536157
MIRT711100 hsa-miR-181d-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614685 26573 ENSG00000167981
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LX8
Protein name Zinc finger protein 597
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 13 54 KRAB box Family
PF00096 zf-C2H2 156 178 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 184 206 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 212 234 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 341 363 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 397 419 Zinc finger, C2H2 type Domain
Sequence
MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPE
INQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLL
VTIENHTPLVELSEYLGTNTLSEILDSPWEGAKNVYKCPECDQNFSDHSYLVLHQKIHSG
EKKHKCGDCGKIFNHRANLRTHRRIHTGEKPYKCAKCSASFRQHSHLSRHMNSHVKEKPY
TCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTK
CMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTFPCFSELISHQ
NIH
TEERPHKCKTCEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHI
KNTT
Sequence length 424
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Congenital Abnormalities Congenital abnormalities Pubtator 32576657 Associate
★☆☆☆☆
Found in Text Mining only
Dystonia 16 Dystonia Pubtator 30242100 Associate
★☆☆☆☆
Found in Text Mining only
Dystonia 16 Dystonia Pubtator 32576657 Stimulate
★☆☆☆☆
Found in Text Mining only
Growth Disorders Growth disorder Pubtator 32576657 Associate
★☆☆☆☆
Found in Text Mining only
Hemimegalencephaly Hemimegalencephaly Pubtator 28864461 Associate
★☆☆☆☆
Found in Text Mining only