Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	145864
Gene name	Hyaluronan and proteoglycan link protein 3
Gene symbol	HAPLN3
Synonyms (NCBI Gene)	EXLD1HsT19883
Chromosome	15
Chromosome location	15q26.1
Summary	This gene belongs to the hyaluronan and proteoglycan binding link protein gene family. The protein encoded by this gene may function in hyaluronic acid binding and cell adhesion. [provided by RefSeq, Jul 2008]

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments
MIRT1040720	hsa-miR-103b	CLIP-seq
MIRT1040721	hsa-miR-1228	CLIP-seq
MIRT1040722	hsa-miR-2682	CLIP-seq
MIRT1040723	hsa-miR-296-5p	CLIP-seq
MIRT1040724	hsa-miR-29a	CLIP-seq
MIRT1040725	hsa-miR-29b	CLIP-seq
MIRT1040726	hsa-miR-29c	CLIP-seq
MIRT1040727	hsa-miR-329	CLIP-seq
MIRT1040728	hsa-miR-3616-3p	CLIP-seq
MIRT1040729	hsa-miR-3622a-3p	CLIP-seq
MIRT1040730	hsa-miR-3622b-3p	CLIP-seq
MIRT1040731	hsa-miR-362-3p	CLIP-seq
MIRT1040732	hsa-miR-3714	CLIP-seq
MIRT1040733	hsa-miR-3941	CLIP-seq
MIRT1040734	hsa-miR-3973	CLIP-seq
MIRT1040735	hsa-miR-4286	CLIP-seq
MIRT1040736	hsa-miR-449c	CLIP-seq
MIRT1040737	hsa-miR-4721	CLIP-seq
MIRT1040738	hsa-miR-4729	CLIP-seq
MIRT1040739	hsa-miR-4749-3p	CLIP-seq
MIRT1040740	hsa-miR-544b	CLIP-seq
MIRT1040741	hsa-miR-548k	CLIP-seq
MIRT1040742	hsa-miR-603	CLIP-seq
MIRT1040743	hsa-miR-767-5p	CLIP-seq
MIRT1040724	hsa-miR-29a	CLIP-seq
MIRT1040725	hsa-miR-29b	CLIP-seq
MIRT1040726	hsa-miR-29c	CLIP-seq
MIRT1040734	hsa-miR-3973	CLIP-seq
MIRT1040738	hsa-miR-4729	CLIP-seq
MIRT1040739	hsa-miR-4749-3p	CLIP-seq
MIRT1040741	hsa-miR-548k	CLIP-seq
MIRT1040743	hsa-miR-767-5p	CLIP-seq
MIRT2544476	hsa-miR-4261	CLIP-seq
MIRT2544477	hsa-miR-4768-3p	CLIP-seq
MIRT1040723	hsa-miR-296-5p	CLIP-seq
MIRT1040728	hsa-miR-3616-3p	CLIP-seq
MIRT1040729	hsa-miR-3622a-3p	CLIP-seq
MIRT1040730	hsa-miR-3622b-3p	CLIP-seq
MIRT2544476	hsa-miR-4261	CLIP-seq
MIRT1040735	hsa-miR-4286	CLIP-seq
MIRT1040737	hsa-miR-4721	CLIP-seq
MIRT1040739	hsa-miR-4749-3p	CLIP-seq
MIRT2544477	hsa-miR-4768-3p	CLIP-seq
MIRT1040740	hsa-miR-544b	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IBA
GO:0005540	Function	Hyaluronic acid binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007417	Process	Central nervous system development	IBA
GO:0045202	Component	Synapse	IBA
GO:0072534	Component	Perineuronal net	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q96S86

Protein name

Hyaluronan and proteoglycan link protein 3

Protein function

May function in hyaluronic acid binding.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	52 → 163	Immunoglobulin V-set domain	Domain
PF00193	Xlink	166 → 260	Extracellular link domain	Domain
PF00193	Xlink	267 → 357	Extracellular link domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in spleen and placenta. {ECO:0000269|PubMed:12663660}.

Sequence

MGLLLLVPLLLLPGSYGLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFT
YQGASVILPCRYRYEPALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVH
LRQDKEHDVSLEIQDLRLEDYGRYRCEVIDGLEDESGLVELELRGVVFPYQSPNGRYQFN
FHEGQQVCAEQAAVVASFEQLFRAWEEGLDWCNAGWLQDATVQYPIMLPRQPCGGPGLAP
GVRSYGPRHRRLHRYDVFCFATALKGRVYYLEHPEKLTLTEAREACQEDDATIAKVGQLF
AAWKFHGLDRCDAGWLADGSVRYPVVHPHPNCGPPEPGVRSFGFPDPQSRLYGVYCYRQH

Sequence length

360

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	20664984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36374334, 39871215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	25676578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	23897225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20664984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33753855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28084441, 29465788, 32486483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20950796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	GWASCAT_DG	30738427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28474731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HAPLN3 (hyaluronan and proteoglycan link protein 3)