Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1455
Gene name	Casein kinase 1 gamma 2
Gene symbol	CSNK1G2
Synonyms (NCBI Gene)	CK1g2
Chromosome	19
Chromosome location	19p13.3

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026979	hsa-miR-107	Microarray	20489155
MIRT028634	hsa-miR-30a-5p	Proteomics	18668040
MIRT650076	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650075	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650074	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT650073	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650072	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT650071	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT650070	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT199844	hsa-miR-155-5p	PAR-CLIP	22291592
MIRT199847	hsa-miR-3121-3p	PAR-CLIP	22291592
MIRT498174	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT498173	hsa-miR-4759	PAR-CLIP	22291592
MIRT498172	hsa-miR-4305	PAR-CLIP	22291592
MIRT199845	hsa-miR-432-5p	PAR-CLIP	22291592
MIRT498171	hsa-miR-6503-3p	PAR-CLIP	22291592
MIRT498170	hsa-miR-7154-3p	PAR-CLIP	22291592
MIRT498169	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT498168	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT199852	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT199851	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT199846	hsa-miR-569	PAR-CLIP	22291592
MIRT498167	hsa-miR-4443	PAR-CLIP	22291592
MIRT199849	hsa-miR-6515-5p	PAR-CLIP	22291592
MIRT650076	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650075	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650074	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT650073	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650072	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT650071	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT650070	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT199844	hsa-miR-155-5p	PAR-CLIP	22291592
MIRT199847	hsa-miR-3121-3p	PAR-CLIP	22291592
MIRT498174	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT498173	hsa-miR-4759	PAR-CLIP	22291592
MIRT498172	hsa-miR-4305	PAR-CLIP	22291592
MIRT199845	hsa-miR-432-5p	PAR-CLIP	22291592
MIRT498171	hsa-miR-6503-3p	PAR-CLIP	22291592
MIRT498170	hsa-miR-7154-3p	PAR-CLIP	22291592
MIRT498169	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT498168	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT199852	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT199851	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT199846	hsa-miR-569	PAR-CLIP	22291592
MIRT498167	hsa-miR-4443	PAR-CLIP	22291592
MIRT199849	hsa-miR-6515-5p	PAR-CLIP	22291592
MIRT912675	hsa-miR-103a	CLIP-seq
MIRT912676	hsa-miR-1182	CLIP-seq
MIRT912677	hsa-miR-1184	CLIP-seq
MIRT912678	hsa-miR-1291	CLIP-seq
MIRT912679	hsa-miR-149	CLIP-seq
MIRT912680	hsa-miR-2115	CLIP-seq
MIRT912681	hsa-miR-3064-5p	CLIP-seq
MIRT912682	hsa-miR-3151	CLIP-seq
MIRT912683	hsa-miR-3176	CLIP-seq
MIRT912684	hsa-miR-328	CLIP-seq
MIRT912685	hsa-miR-3614-5p	CLIP-seq
MIRT912686	hsa-miR-3686	CLIP-seq
MIRT912687	hsa-miR-3919	CLIP-seq
MIRT912688	hsa-miR-3922-3p	CLIP-seq
MIRT912689	hsa-miR-4292	CLIP-seq
MIRT912690	hsa-miR-4418	CLIP-seq
MIRT912691	hsa-miR-4422	CLIP-seq
MIRT912692	hsa-miR-4505	CLIP-seq
MIRT912693	hsa-miR-4520a-5p	CLIP-seq
MIRT912694	hsa-miR-4520b-5p	CLIP-seq
MIRT912695	hsa-miR-4646-5p	CLIP-seq
MIRT912696	hsa-miR-4651	CLIP-seq
MIRT912697	hsa-miR-4652-3p	CLIP-seq
MIRT912698	hsa-miR-4711-5p	CLIP-seq
MIRT912699	hsa-miR-4747-5p	CLIP-seq
MIRT912700	hsa-miR-4755-3p	CLIP-seq
MIRT912701	hsa-miR-4756-3p	CLIP-seq
MIRT912702	hsa-miR-4794	CLIP-seq
MIRT912703	hsa-miR-509-3-5p	CLIP-seq
MIRT912704	hsa-miR-509-5p	CLIP-seq
MIRT912705	hsa-miR-548ae	CLIP-seq
MIRT912706	hsa-miR-548aj	CLIP-seq
MIRT912707	hsa-miR-548am	CLIP-seq
MIRT912708	hsa-miR-548p	CLIP-seq
MIRT912709	hsa-miR-548x	CLIP-seq
MIRT912710	hsa-miR-608	CLIP-seq
MIRT912711	hsa-miR-622	CLIP-seq
MIRT912675	hsa-miR-103a	CLIP-seq
MIRT912676	hsa-miR-1182	CLIP-seq
MIRT912679	hsa-miR-149	CLIP-seq
MIRT1970642	hsa-miR-155	CLIP-seq
MIRT912680	hsa-miR-2115	CLIP-seq
MIRT912681	hsa-miR-3064-5p	CLIP-seq
MIRT1970643	hsa-miR-3065-3p	CLIP-seq
MIRT912683	hsa-miR-3176	CLIP-seq
MIRT912685	hsa-miR-3614-5p	CLIP-seq
MIRT912686	hsa-miR-3686	CLIP-seq
MIRT912688	hsa-miR-3922-3p	CLIP-seq
MIRT1970644	hsa-miR-432	CLIP-seq
MIRT1970645	hsa-miR-4645-5p	CLIP-seq
MIRT912697	hsa-miR-4652-3p	CLIP-seq
MIRT1970646	hsa-miR-4673	CLIP-seq
MIRT912702	hsa-miR-4794	CLIP-seq
MIRT1970647	hsa-miR-502-5p	CLIP-seq
MIRT912675	hsa-miR-103a	CLIP-seq
MIRT2206495	hsa-miR-3177-3p	CLIP-seq
MIRT2206496	hsa-miR-3186-3p	CLIP-seq
MIRT912685	hsa-miR-3614-5p	CLIP-seq
MIRT912686	hsa-miR-3686	CLIP-seq
MIRT912687	hsa-miR-3919	CLIP-seq
MIRT2206497	hsa-miR-4290	CLIP-seq
MIRT912689	hsa-miR-4292	CLIP-seq
MIRT2206498	hsa-miR-4485	CLIP-seq
MIRT912697	hsa-miR-4652-3p	CLIP-seq
MIRT2206499	hsa-miR-4707-3p	CLIP-seq
MIRT912698	hsa-miR-4711-5p	CLIP-seq
MIRT912701	hsa-miR-4756-3p	CLIP-seq
MIRT2206500	hsa-miR-4758-3p	CLIP-seq
MIRT2206501	hsa-miR-564	CLIP-seq
MIRT2436483	hsa-miR-1285	CLIP-seq
MIRT2206495	hsa-miR-3177-3p	CLIP-seq
MIRT2436484	hsa-miR-3187-5p	CLIP-seq
MIRT912689	hsa-miR-4292	CLIP-seq
MIRT2436485	hsa-miR-4691-3p	CLIP-seq
MIRT2206501	hsa-miR-564	CLIP-seq
MIRT2436486	hsa-miR-612	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	25500533
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9403068
GO:0005515	Function	Protein binding	IPI	15917222, 16189514, 25416956, 28514442, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	9403068
GO:0006897	Process	Endocytosis	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	9403068
GO:0016020	Component	Membrane	HDA	19946888
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602214	2455	ENSG00000133275

P78368

Protein name

Casein kinase I isoform gamma-2 (CKI-gamma 2) (EC 2.7.11.1)

Protein function

Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By simi

PDB

2C47

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	46 → 299	Protein kinase domain	Domain
PF12605	CK1gamma_C	356 → 385	Casein kinase 1 gamma C terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:9403068}.

Sequence

MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKR
QHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSK
NQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK

Sequence length

415

Interactions

View interactions

	KEGG		Reactome
	Hedgehog signaling pathway		Sphingolipid de novo biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amelogenesis Imperfecta	Amelogenesis imperfecta	BEFREE	27222304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37975370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	LHGDN	15300631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	17660800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	17660800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16247451, 30026872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21317463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30026872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17660800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizure, Febrile, Simple	Seizure	BEFREE	15342122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17660800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	17660800		★★★★★ ★☆☆☆☆ Found in Text Mining only

CSNK1G2 (casein kinase 1 gamma 2)