Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	145447
Gene name	Abhydrolase domain containing 12B
Gene symbol	ABHD12B
Synonyms (NCBI Gene)	BEM46L3C14orf29c14_5314
Chromosome	14
Chromosome location	14q22.1

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018993	hsa-miR-335-5p	Microarray	18185580
MIRT759540	hsa-miR-2053	CLIP-seq
MIRT759541	hsa-miR-31	CLIP-seq
MIRT759542	hsa-miR-3662	CLIP-seq
MIRT759543	hsa-miR-3674	CLIP-seq
MIRT759544	hsa-miR-4777-5p	CLIP-seq
MIRT1923838	hsa-miR-128	CLIP-seq
MIRT1923839	hsa-miR-27a	CLIP-seq
MIRT1923840	hsa-miR-27b	CLIP-seq
MIRT1923841	hsa-miR-335	CLIP-seq
MIRT1923842	hsa-miR-4277	CLIP-seq
MIRT1923843	hsa-miR-4314	CLIP-seq
MIRT1923844	hsa-miR-4488	CLIP-seq
MIRT1923845	hsa-miR-4492	CLIP-seq
MIRT1923846	hsa-miR-4498	CLIP-seq
MIRT1923847	hsa-miR-4505	CLIP-seq
MIRT1923848	hsa-miR-4646-5p	CLIP-seq
MIRT1923849	hsa-miR-4667-5p	CLIP-seq
MIRT1923850	hsa-miR-4697-5p	CLIP-seq
MIRT1923851	hsa-miR-4700-5p	CLIP-seq
MIRT1923852	hsa-miR-4747-5p	CLIP-seq
MIRT1923853	hsa-miR-637	CLIP-seq
MIRT1923854	hsa-miR-762	CLIP-seq
MIRT1923838	hsa-miR-128	CLIP-seq
MIRT1923839	hsa-miR-27a	CLIP-seq
MIRT1923840	hsa-miR-27b	CLIP-seq
MIRT1923841	hsa-miR-335	CLIP-seq
MIRT1923842	hsa-miR-4277	CLIP-seq
MIRT1923843	hsa-miR-4314	CLIP-seq
MIRT1923844	hsa-miR-4488	CLIP-seq
MIRT1923845	hsa-miR-4492	CLIP-seq
MIRT1923846	hsa-miR-4498	CLIP-seq
MIRT1923847	hsa-miR-4505	CLIP-seq
MIRT1923848	hsa-miR-4646-5p	CLIP-seq
MIRT1923849	hsa-miR-4667-5p	CLIP-seq
MIRT1923850	hsa-miR-4697-5p	CLIP-seq
MIRT1923851	hsa-miR-4700-5p	CLIP-seq
MIRT1923852	hsa-miR-4747-5p	CLIP-seq
MIRT1923853	hsa-miR-637	CLIP-seq
MIRT1923854	hsa-miR-762	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IBA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0006660	Process	Phosphatidylserine catabolic process	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	IBA
GO:0052651	Process	Monoacylglycerol catabolic process	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q7Z5M8

Protein name

Protein ABHD12B (EC 3.-.-.-) (Abhydrolase domain-containing protein 12B) (Alpha/beta hydrolase domain-containing protein 12B)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12146	Hydrolase_4	137 → 280	Serine aminopeptidase, S33	Family

Sequence

MDAQDCQAAASPEPPGPPARSCVAAWWDMVDRNLRYFPHSCSMLGRKIAALYDSFTSKSL
KEHVFLPLIDMLIYFNFFKAPFLVDLKKPELKIPHTVNFYLRVEPGVMLGIWHTVPSCRG
EDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFG
DSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAI
VLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILH
GEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ
WS

Sequence length

362

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	26659575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	25056994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	25056994, 36360171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35179257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	26659575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ABHD12B (abhydrolase domain containing 12B)