Gene Gene information from NCBI Gene database.
Entrez ID 1446
Gene name Casein alpha s1
Gene symbol CSN1S1
Synonyms (NCBI Gene)
CASACSN1
Chromosome 4
Chromosome location 4q13.3
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT755329 hsa-miR-380-3p Luciferase reporter assayWestern blottingqRT-PCRCLIP-seq 37170511
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space HDA 16502470
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
115450 2445 ENSG00000126545
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P47710
Protein name Alpha-S1-casein [Cleaved into: Casoxin-D]
Protein function Important role in the capacity of milk to transport calcium phosphate.; Casoxin D acts as opioid antagonist and has vasorelaxing activity mediated by bradykinin B1 receptors.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Mammary gland specific. Secreted in milk.
Sequence
MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQ
TDEIKDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQ
EQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNN
VMLQW
Sequence length 185
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Miscellaneous transport and binding events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHONDROMALACIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 31664702 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 10367247, 23453899
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 32158625 Associate
★☆☆☆☆
Found in Text Mining only
Dyssomnias Dyssomnia BEFREE 31252661
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 10367247, 23453899
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of penis Penile cancer BEFREE 27325650
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 27325650
★☆☆☆☆
Found in Text Mining only
Osteoarthritis Osteoarthritis Pubtator 29258882 Stimulate
★☆☆☆☆
Found in Text Mining only
Serum Sickness Serum Sickness BEFREE 22496735
★☆☆☆☆
Found in Text Mining only
Sleep Disorders Sleep Disorders BEFREE 31252661
★☆☆☆☆
Found in Text Mining only