CSK (C-terminal Src kinase)

Gene

• Entrez ID: 1445
• Gene name: C-terminal Src kinase
• Gene symbol: CSK
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q24.1
• Summary: The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003960	hsa-miR-140-5p	Microarray	17875710
MIRT030606	hsa-miR-24-3p	Microarray	19748357
MIRT035928	hsa-miR-1180-3p	CLASH	23622248
MIRT755804	hsa-miR-192-3p	Luciferase reporter assay, Western blotting, qRT-PCR, RNA pull down assay	36914869
MIRT911892	hsa-miR-1225-5p	CLIP-seq
MIRT911893	hsa-miR-1302	CLIP-seq
MIRT911894	hsa-miR-130a	CLIP-seq
MIRT911895	hsa-miR-130b	CLIP-seq
MIRT911896	hsa-miR-148a	CLIP-seq
MIRT911897	hsa-miR-148b	CLIP-seq
MIRT911898	hsa-miR-151-5p	CLIP-seq
MIRT911899	hsa-miR-151b	CLIP-seq
MIRT911900	hsa-miR-152	CLIP-seq
MIRT911901	hsa-miR-2110	CLIP-seq
MIRT911902	hsa-miR-2467-5p	CLIP-seq
MIRT911903	hsa-miR-301a	CLIP-seq
MIRT911904	hsa-miR-301b	CLIP-seq
MIRT911905	hsa-miR-3150b-3p	CLIP-seq
MIRT911906	hsa-miR-3188	CLIP-seq
MIRT911907	hsa-miR-342-3p	CLIP-seq
MIRT911908	hsa-miR-346	CLIP-seq
MIRT911909	hsa-miR-365	CLIP-seq
MIRT911910	hsa-miR-3656	CLIP-seq
MIRT911911	hsa-miR-3660	CLIP-seq
MIRT911912	hsa-miR-3662	CLIP-seq
MIRT911913	hsa-miR-3666	CLIP-seq
MIRT911914	hsa-miR-3682-5p	CLIP-seq
MIRT911915	hsa-miR-3975	CLIP-seq
MIRT911916	hsa-miR-4271	CLIP-seq
MIRT911917	hsa-miR-4279	CLIP-seq
MIRT911918	hsa-miR-4295	CLIP-seq
MIRT911919	hsa-miR-4298	CLIP-seq
MIRT911920	hsa-miR-4457	CLIP-seq
MIRT911921	hsa-miR-4462	CLIP-seq
MIRT911922	hsa-miR-4526	CLIP-seq
MIRT911923	hsa-miR-454	CLIP-seq
MIRT911924	hsa-miR-4641	CLIP-seq
MIRT911925	hsa-miR-4725-3p	CLIP-seq
MIRT911926	hsa-miR-4731-5p	CLIP-seq
MIRT911927	hsa-miR-4732-3p	CLIP-seq
MIRT911928	hsa-miR-4750	CLIP-seq
MIRT911929	hsa-miR-4784	CLIP-seq
MIRT911930	hsa-miR-485-5p	CLIP-seq
MIRT911931	hsa-miR-513b	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911933	hsa-miR-578	CLIP-seq
MIRT911934	hsa-miR-602	CLIP-seq
MIRT911935	hsa-miR-643	CLIP-seq
MIRT911936	hsa-miR-885-3p	CLIP-seq
MIRT911894	hsa-miR-130a	CLIP-seq
MIRT911895	hsa-miR-130b	CLIP-seq
MIRT911896	hsa-miR-148a	CLIP-seq
MIRT911897	hsa-miR-148b	CLIP-seq
MIRT911898	hsa-miR-151-5p	CLIP-seq
MIRT911899	hsa-miR-151b	CLIP-seq
MIRT911900	hsa-miR-152	CLIP-seq
MIRT911903	hsa-miR-301a	CLIP-seq
MIRT911904	hsa-miR-301b	CLIP-seq
MIRT911905	hsa-miR-3150b-3p	CLIP-seq
MIRT911937	hsa-miR-342-5p	CLIP-seq
MIRT911913	hsa-miR-3666	CLIP-seq
MIRT911918	hsa-miR-4295	CLIP-seq
MIRT911921	hsa-miR-4462	CLIP-seq
MIRT911923	hsa-miR-454	CLIP-seq
MIRT911938	hsa-miR-4664-5p	CLIP-seq
MIRT911929	hsa-miR-4784	CLIP-seq
MIRT911934	hsa-miR-602	CLIP-seq
MIRT1970311	hsa-miR-4417	CLIP-seq
MIRT1970312	hsa-miR-4437	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911924	hsa-miR-4641	CLIP-seq
MIRT2509566	hsa-miR-4758-3p	CLIP-seq
MIRT2509567	hsa-miR-552	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002682	Process	Regulation of immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	1945408
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	7507203, 10026153, 10790433, 12446738, 14665621, 15683240, 16354697, 17911601, 18070987, 18614016, 19167335, 21930792, 24902122, 28514442, 31980649, 32296183, 32707033, 33961781
GO:0005515	Function	Protein binding	TAS	8890164
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	8890164
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IPI	10790433
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0006468	Process	Protein phosphorylation	TAS	1945408
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010989	Process	Negative regulation of low-density lipoprotein particle clearance	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0031295	Process	T cell costimulation	TAS
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	17911601
GO:0034332	Process	Adherens junction organization	IBA
GO:0034332	Process	Adherens junction organization	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042802	Function	Identical protein binding	IPI	19888460
GO:0042997	Process	Negative regulation of Golgi to plasma membrane protein transport	IDA	20605918
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050765	Process	Negative regulation of phagocytosis	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0060368	Process	Regulation of Fc receptor mediated stimulatory signaling pathway	IBA
GO:0060368	Process	Regulation of Fc receptor mediated stimulatory signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070064	Function	Proline-rich region binding	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IEA

Other IDs

• MIM: 124095
• HGNC: 2444
• e!Ensembl: ENSG00000103653

Protein

• UniProt ID: P41240
• Protein name: Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-Src kinase) (Protein-tyrosine kinase CYL)
• Protein function: Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) inc
• PDB: 1BYG, 1CSK, 3D7T, 3D7U, 3EAC, 3EAZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	15 → 62	SH3 domain	Domain
  PF00017	SH2	82 → 156	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	195 → 440	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung and macrophages. {ECO:0000269|PubMed:1371489}.
• Sequence:

  MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
  PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
  SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
  DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
  TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
  AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
  KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
  NCWHLDAAMRPSFLQLREQLEHIKTHELHL

• Sequence length: 450

Pathways

KEGG:

Epithelial cell signaling in Helicobacter pylori infection

Reactome:

GAB1 signalosome
Phosphorylation of CD3 and TCR zeta chains
Integrin signaling
PD-1 signaling
MAP2K and MAPK activation
Signaling by moderate kinase activity BRAF mutants
Signaling by high-kinase activity BRAF mutants
Signaling by BRAF and RAF fusions
Paradoxical activation of RAF signaling by kinase inactive BRAF
Signaling downstream of RAS mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
15q24 Microdeletion	15q24 Microdeletion	BEFREE	22216833		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15208781, 27092776, 28874816	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28874816	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23359562, 23946333, 24333531, 26458874, 28874816		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	18337451		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11007774, 12941830, 14704150, 29987050		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14704150, 20010872, 29987050	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24648518		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32335258, 40612868	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	19583841	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33671013	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27765068		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	36814110	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cleft Palate	Cleft palate	Pubtator	32241273	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15961079, 19620276		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12402152		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	7681838	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11161376, 11443610, 15961079		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11161376, 20010872	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11443610		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15961079		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	30525989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	11872746		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27102411		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27102411		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15208781	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26631741		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	27038655		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	23946333		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15561776, 8979366		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	26458874		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	20921432, 28273873	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	19960030, 20414254, 20479155, 20921432, 21633377, 22959498, 23591986, 28273873, 30291896		★☆☆☆☆ Found in Text Mining only
Lens Diseases	Eye Diseases	BEFREE	31703690		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33592500, 40255396	Associate	★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	23042117		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25149533, 29951557		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17195233, 23042117	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23042117, 25720506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	23042117		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	11007774, 12941830, 14704150, 29987050		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27765068		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17363565		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11007774, 22249264, 25780058		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10958949, 15961079, 19620276		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17060931, 18332219		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	33345275	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	19198071		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27391433	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11084024, 12941830, 15961079, 18056464, 21242978, 21388951, 23580575, 7903421		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26993602, 30262428		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26809240, 2830484		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	17060931		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30217759		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	16421247	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27765068		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21242978		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	21242978		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17329398		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30116401		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10411542, 28874816		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29401603		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	38235873	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10640727	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	22407130, 25569146, 32977850	Associate	★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	30828837		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17363565		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28460635, 38235873	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	23580575		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	GWASCAT_DG	31672989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16103120	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33671013	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	26458874		★☆☆☆☆ Found in Text Mining only