Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	144195
Gene name	Solute carrier family 2 member 14
Gene symbol	SLC2A14
Synonyms (NCBI Gene)	GLUT14SLC2A3P3
Chromosome	12
Chromosome location	12p13.31
Summary	Members of the glucose transporter (GLUT) family, including SLC2A14, are highly conserved integral membrane proteins that transport hexoses such as glucose and fructose into all mammalian cells. GLUTs show tissue and cell-type specific expression (Wu and

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019157	hsa-miR-335-5p	Microarray	18185580
MIRT025478	hsa-miR-34a-5p	Proteomics	21566225
MIRT025478	hsa-miR-34a-5p	Proteomics	21566225
MIRT027782	hsa-miR-98-5p	Microarray	19088304
MIRT554224	hsa-miR-498	PAR-CLIP	21572407
MIRT467809	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT467808	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT467807	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT467806	hsa-miR-3154	PAR-CLIP	23592263
MIRT467805	hsa-miR-4499	PAR-CLIP	23592263
MIRT467804	hsa-miR-576-3p	PAR-CLIP	23592263
MIRT467803	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT467802	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT467801	hsa-miR-1182	PAR-CLIP	23592263
MIRT467800	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT467799	hsa-miR-4251	PAR-CLIP	23592263
MIRT467797	hsa-miR-4329	PAR-CLIP	23592263
MIRT467798	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT467796	hsa-miR-5681a	PAR-CLIP	23592263
MIRT467795	hsa-miR-7515	PAR-CLIP	23592263
MIRT467794	hsa-miR-6857-3p	PAR-CLIP	23592263
MIRT467793	hsa-miR-873-3p	PAR-CLIP	23592263
MIRT467792	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT467791	hsa-miR-4770	PAR-CLIP	23592263
MIRT467790	hsa-miR-6088	PAR-CLIP	23592263
MIRT467789	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT467788	hsa-miR-1273f	PAR-CLIP	23592263
MIRT467787	hsa-miR-3153	PAR-CLIP	23592263
MIRT467786	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT467785	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT554224	hsa-miR-498	PAR-CLIP	21572407
MIRT467809	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT467808	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT467807	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT467806	hsa-miR-3154	PAR-CLIP	23592263
MIRT467805	hsa-miR-4499	PAR-CLIP	23592263
MIRT467804	hsa-miR-576-3p	PAR-CLIP	23592263
MIRT467803	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT467802	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT467801	hsa-miR-1182	PAR-CLIP	23592263
MIRT467800	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT467799	hsa-miR-4251	PAR-CLIP	23592263
MIRT467797	hsa-miR-4329	PAR-CLIP	23592263
MIRT467798	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT467796	hsa-miR-5681a	PAR-CLIP	23592263
MIRT467795	hsa-miR-7515	PAR-CLIP	23592263
MIRT467794	hsa-miR-6857-3p	PAR-CLIP	23592263
MIRT467793	hsa-miR-873-3p	PAR-CLIP	23592263
MIRT467792	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT467791	hsa-miR-4770	PAR-CLIP	23592263
MIRT467790	hsa-miR-6088	PAR-CLIP	23592263
MIRT467789	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT467788	hsa-miR-1273f	PAR-CLIP	23592263
MIRT467787	hsa-miR-3153	PAR-CLIP	23592263
MIRT467786	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT467785	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT1358730	hsa-miR-1264	CLIP-seq
MIRT1358731	hsa-miR-1265	CLIP-seq
MIRT1358732	hsa-miR-1321	CLIP-seq
MIRT1358733	hsa-miR-1343	CLIP-seq
MIRT1358734	hsa-miR-198	CLIP-seq
MIRT1358735	hsa-miR-2115	CLIP-seq
MIRT1358736	hsa-miR-2964a-5p	CLIP-seq
MIRT1358737	hsa-miR-298	CLIP-seq
MIRT1358738	hsa-miR-3119	CLIP-seq
MIRT1358739	hsa-miR-3605-5p	CLIP-seq
MIRT1358740	hsa-miR-4419a	CLIP-seq
MIRT1358741	hsa-miR-4490	CLIP-seq
MIRT1358742	hsa-miR-4510	CLIP-seq
MIRT1358743	hsa-miR-4649-3p	CLIP-seq
MIRT1358744	hsa-miR-4686	CLIP-seq
MIRT1358745	hsa-miR-4728-5p	CLIP-seq
MIRT1358746	hsa-miR-4739	CLIP-seq
MIRT1358747	hsa-miR-4756-5p	CLIP-seq
MIRT1358748	hsa-miR-516a-3p	CLIP-seq
MIRT1358749	hsa-miR-665	CLIP-seq
MIRT2330561	hsa-miR-1184	CLIP-seq
MIRT1358733	hsa-miR-1343	CLIP-seq
MIRT2330562	hsa-miR-3065-5p	CLIP-seq
MIRT2330563	hsa-miR-4418	CLIP-seq
MIRT2330564	hsa-miR-4699-5p	CLIP-seq
MIRT2330565	hsa-miR-495	CLIP-seq
MIRT2330566	hsa-miR-509-3-5p	CLIP-seq
MIRT2330567	hsa-miR-509-5p	CLIP-seq
MIRT2394713	hsa-miR-3924	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	27460888
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007283	Process	Spermatogenesis	IEA
GO:0016020	Component	Membrane	IEA
GO:0016235	Component	Aggresome	IDA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0033300	Function	Dehydroascorbic acid transmembrane transporter activity	IDA	28971850
GO:0033300	Function	Dehydroascorbic acid transmembrane transporter activity	IEA
GO:0046323	Process	D-glucose import	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	28971850
GO:0055056	Function	D-glucose transmembrane transporter activity	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070837	Process	Dehydroascorbic acid transport	IBA
GO:0070837	Process	Dehydroascorbic acid transport	IDA	28971850
GO:1904659	Process	D-glucose transmembrane transport	IDA	28971850
GO:1904659	Process	D-glucose transmembrane transport	IEA

MIM	HGNC	e!Ensembl
611039	18301	ENSG00000173262

Q8TDB8

Protein name

Solute carrier family 2, facilitated glucose transporter member 14 (Glucose transporter type 14) (GLUT-14)

Protein function

Hexose transporter that can mediate the transport of glucose and dehydroascorbate across the cell membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	37 → 489	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in testis (PubMed:12504846, PubMed:27460888). Also expressed in small intestine, liver and kidney (PubMed:27460888). {ECO:0000269|PubMed:12504846, ECO:0000269|PubMed:27460888}.

Sequence

MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET
IIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLI
VNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGT
LNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINR
KKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVL
QLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHM
IGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQG
PRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGR
TFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV

Sequence length

520

Interactions

View interactions

	Reactome
			Cellular hexose transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
22q11 Deletion Syndrome	22q11 deletion syndrome	BEFREE	27604636		★★★★★ ★☆☆☆☆ Found in Text Mining only
22q11 Deletion Syndrome	22q11 deletion syndrome	Pubtator	27604636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	22421804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34525987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	27604636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	27604636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28971850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31996098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	GWASCAT_DG	30823506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	25475535		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	31996098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC2A14 (solute carrier family 2 member 14)